Validation Data Gallery
Tested Applications
| Positive IHC detected in | human pituitary tissue, rat testis tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | COS-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 2 publications below |
| IF | See 1 publications below |
Product Information
16525-1-AP targets Prolactin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9764 Product name: Recombinant human PRL protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-227 aa of BC015850 Sequence: MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC 相同性解析による交差性が予測される生物種 |
| Full Name | prolactin |
| Calculated molecular weight | 227 aa, 26 kDa |
| GenBank accession number | BC015850 |
| Gene Symbol | Prolactin/PRL |
| Gene ID (NCBI) | 5617 |
| RRID | AB_2935439 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01236 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Prolactin is also named as PRL and belongs to the somatotropin/prolactin family. The proteins encoded by PRL are secreted into the cell surroundings. And they are abundantly expressed in pituitary gland, adenohypophysis, decidua and testis. Indeed, chemically, prolactin appears in a multiplicity of posttranslational forms ranging from size variants to chemical modifications such as phosphorylation or glycosylation. It is not only synthesized in the pituitary gland, as originally described, but also within the central nervous system, the immune system, the uterus and its associated tissues of conception, and even the mammary gland itself (PMID: 11015620). Prolactin acts primarily on the mammary gland by promoting lactation (PMID: 30546056). The major form of prolactin found in the pituitary gland is 23 kDa, variants of prolactin have been characterized in many mammals, including humans. Of the cleaved forms that have been characterized, 14 kDa, 16 kDa, and 22 kDa prolactin variants have been most widely studied (PMID: 7937959) (PMID: 8425495).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Prolactin antibody 16525-1-AP | Download protocol |
| IHC protocol for Prolactin antibody 16525-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Med PYK2 promotes cell proliferation and epithelial-mesenchymal transition in endometriosis by phosphorylating Snail1 | ||
Mol Cell Endocrinol Embryo-derived human chorionic gonadotropin promotes human decidualization through activating epithelial prostaglandin F2α secretion | ||
J Obstet Gynaecol Abnormal expression of Hippo-YAP1 signalling pathway and progesterone resistance mechanism in endometrial polyps | ||
Transl Cancer Res Prolactin (PRL), placenta growth factor (PIGF) and nerve growth factor receptor (NGFR) as biomarkers for early diagnosis and prognosis in patients with esophageal squamous cell carcinoma (ESCC) | ||
Biol Reprod Impaired Decidualization and Angiogenesis in Eutopic Endometrium of Endometriosis: Insights from In Vitro Models |






