Validation Data Gallery
Tested Applications
Positive WB detected in | mouse brain tissue, mouse kidney tissue, rat brain tissue, mouse lung tissue, rat lung tissue |
Positive IP detected in | mouse brain tissue |
Positive IHC detected in | human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:3000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 28 publications below |
IHC | See 7 publications below |
Product Information
21646-1-AP targets PRKG1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, bovine |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16333 Product name: Recombinant human PRKG1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-178 aa of BC127090 Sequence: MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPG 相同性解析による交差性が予測される生物種 |
Full Name | protein kinase, cGMP-dependent, type I |
Calculated molecular weight | 686 aa, 78 kDa |
Observed molecular weight | 65-78 kDa |
GenBank accession number | BC127090 |
Gene Symbol | PRKG1 |
Gene ID (NCBI) | 5592 |
RRID | AB_2878897 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q13976 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PRKG1(cGMP-dependent protein kinase 1) is also named as cGK1, PRKG1B, PRKGR1A, PRKGR1B and belongs to the cGMP subfamily. It serves as an integral component of second messenger signaling in a number of biological contexts including cell differentiation, memory, and vasodilation(PMID:21893290). Its activity prevents pathological-level nitric oxide-induced apoptosis and promotes DNA synthesis/cell proliferation in vascular smooth muscle cells(PMID:20060325). PRKG1 has 2 isoforms produced by alternative splicing with the molecular weight of 76 kDa and 78 kDa. The autophosphorylation can increase the kinase activity and it can form a monomer with the molecular weight of 65 kDa that is produced by proteolytic cleavage. SDS-PAGE revealed that proteolysis generated two different monomers with molecular masses of 70 and 68 kDa of CGK1-beta(PMID:8702828).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PRKG1 antibody 21646-1-AP | Download protocol |
IHC protocol for PRKG1 antibody 21646-1-AP | Download protocol |
IP protocol for PRKG1 antibody 21646-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Comput Struct Biotechnol J Integrating single-cell sequencing and clinical insights to explore malignant transformation in odontogenic keratocyst | ||
Environ Pollut Fluoride-induced unrestored arrest during haploid period of spermatogenesis via the regulation of DDX25 in rats. | ||
Clin Sci (Lond) Empagliflozin prevents cardiomyopathy via sGC-cGMP-PKG pathway in type 2 diabetes mice. | ||
Front Cell Dev Biol Myostatin Mutation Promotes Glycolysis by Increasing Phosphorylation of Phosphofructokinase via Activation of PDE5A-cGMP-PKG in Cattle Heart.
| ||
Front Pharmacol Emodin Interferes With Nitroglycerin-Induced Migraine in Rats Through CGMP-PKG Pathway. | ||
Cancer Cell Int NEK7 promotes gastric cancer progression as a cell proliferation regulator. |