Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, MCF-7 cells |
| Positive IHC detected in | mouse testis tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
Product Information
28534-1-AP targets DNA-PKcs in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29100 Product name: Recombinant human PRKDC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 3979-4128 aa of NM_006904 Sequence: LMYSIMVHALRAFRSDPGLLTNTMDVFVKEPSFDWKNFEQKMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGWEPWM 相同性解析による交差性が予測される生物種 |
| Full Name | protein kinase, DNA-activated, catalytic polypeptide |
| Calculated molecular weight | 469 kDa |
| Observed molecular weight | 350-460 kDa |
| GenBank accession number | NM_006904 |
| Gene Symbol | PRKDC |
| Gene ID (NCBI) | 5591 |
| RRID | AB_2881165 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P78527 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PRKDC, also named as HYRC, HYRC1, DNPK1 and p460, belongs to the PI3/PI4-kinase family. PRKDC is a serine/threonine-protein kinase that acts as a molecular sensor for DNA damage. Involved in DNA nonhomologous end joining (NHEJ), PRKDC is required for double-strand break (DSB) repair and V(D)J recombination. PRKDC must be bound to DNA to express its catalytic properties. It promotes processing of hairpin DNA structures in V(D)J recombination by activation of the hairpin endonuclease artemis (DCLRE1C). It is required to protect and align broken ends of DNA. PRKDC may also act as a scaffold protein to aid the localization of DNA repair proteins to the site of damage. It is found at the ends of chromosomes, suggesting a further role in the maintenance of telomeric stability and the prevention of chromosomal end fusion. It also involved in modulation of transcription. It recognizes the substrate consensus sequence [ST]-Q. PRKDC phosphorylates 'Ser-139' of histone variant H2AX/H2AFX, thereby regulating DNA damage response mechanism. It phosphorylates DCLRE1C, c-Abl/ABL1, histone H1, HSPCA, c-jun/JUN, p53/TP53, PARP1, POU2F1, DHX9, SRF, XRCC1, XRCC1, XRCC4, XRCC5, XRCC6, WRN, c-myc/MYC and RFA2. The antibody recognizes the C-term of PRKDC.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DNA-PKcs antibody 28534-1-AP | Download protocol |
| IHC protocol for DNA-PKcs antibody 28534-1-AP | Download protocol |
| WB protocol for DNA-PKcs antibody 28534-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Exp Hematol Peposertib suppresses generation of FLT3-internal tandem duplication formed by contralateral double nicks | ||
Sci Adv SMYD2 inhibition-mediated hypomethylation of Ku70 contributes to impaired nonhomologous end joining repair and antitumor immunity | ||
Commun Biol ATM Inhibition Enhances Knock-in Efficiency by Suppressing AAV-Induced Activation of Apoptotic Pathways. |





