Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | human testis tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 9 publications below |
Product Information
10290-1-AP targets AMPK Gamma 1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0302 Product name: Recombinant human PRKAG1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 165-321 aa of BC000358 Sequence: LYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQA 相同性解析による交差性が予測される生物種 |
| Full Name | protein kinase, AMP-activated, gamma 1 non-catalytic subunit |
| Calculated molecular weight | 38 kDa |
| Observed molecular weight | 35-38 kDa |
| GenBank accession number | BC000358 |
| Gene Symbol | AMPK Gamma 1 |
| Gene ID (NCBI) | 5571 |
| RRID | AB_2268781 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P54619 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Protein kinase, AMP-activated, gamma 1 non-catalytic subunit (PRKAG1, synonyms: AMPKG, MGC8666) is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an catalytic subunit, and non-catalytic and subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and iAMP-activated protein kinase (AMPK) is a highly conserved heterotrimeric serine/threonine kinase widely characterised as a sensor of cellular energetic stress. AMPK is a heterotrimeric complex consisting of a catalytic α-subunit and two regulatory subunits (β and γ). AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. AMPK gamma 1 is one of the gamma regulatory subunits of AMPK.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AMPK Gamma 1 antibody 10290-1-AP | Download protocol |
| IHC protocol for AMPK Gamma 1 antibody 10290-1-AP | Download protocol |
| IP protocol for AMPK Gamma 1 antibody 10290-1-AP | Download protocol |
| WB protocol for AMPK Gamma 1 antibody 10290-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab CircACC1 Regulates Assembly and Activation of AMPK Complex under Metabolic Stress.
| ||
Autophagy Buddleoside alleviates nonalcoholic steatohepatitis by targeting the AMPK-TFEB signaling pathway | ||
JHEP Rep Human umbilical cord mesenchymal stem cell-derived exosomes ameliorate liver steatosis by promoting fatty acid oxidation and reducing fatty acid synthesis | ||
J Med Chem Identification of Pyruvate Carboxylase as the Cellular Target of Natural Bibenzyls with Potent Anticancer Activity against Hepatocellular Carcinoma via Metabolic Reprogramming. | ||
Protein Cell AMPK interacts with DSCAM and plays an important role in netrin-1 induced neurite outgrowth. | ||
Cell Death Dis WW domain-binding protein 2 overexpression prevents diet-induced liver steatosis and insulin resistance through AMPKβ1. |








