Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, MCF-7 cells, human testis tissue, fetal human brain tissue, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells |
| Positive IHC detected in | human testis tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 4 publications below |
| IHC | See 1 publications below |
| IF | See 3 publications below |
Product Information
60202-1-Ig targets Peroxiredoxin 2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0835 Product name: Recombinant human PRDX2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-198 aa of BC003022 Sequence: MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN 相同性解析による交差性が予測される生物種 |
| Full Name | peroxiredoxin 2 |
| Calculated molecular weight | 22 kDa |
| Observed molecular weight | 22 kDa |
| GenBank accession number | BC003022 |
| Gene Symbol | peroxiredoxin 2 |
| Gene ID (NCBI) | 7001 |
| RRID | AB_10918978 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P32119 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PRDX2, also named as TSA, PRP, NKEFB and TDPX1, belongs to the ahpC/TSA family. It is known to act as an antioxidant enzyme whose main function is H2O2 reduction in cells. PRDX2 is involved in redox regulation of the cell. It reduces peroxides with reducing equivalents provided through the thioredoxin system. It may play an important role in eliminating peroxides generated during metabolism. PRDX2 might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2. PRDX2 actions may be related to the expression of NFKB and IKB.(PMID:21248284)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Peroxiredoxin 2 antibody 60202-1-Ig | Download protocol |
| IHC protocol for Peroxiredoxin 2 antibody 60202-1-Ig | Download protocol |
| WB protocol for Peroxiredoxin 2 antibody 60202-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biochem Pharmacol Madecassoside exerts anti-neurodegeneration effects in protein l-isoaspartyl methyltransferase deficient mice via targeting PRDX2-mediated oxidative stress and inflammation | ||
J Exp Clin Cancer Res Compound kushen injection suppresses human acute myeloid leukaemia by regulating the Prdxs/ROS/Trx1 signalling pathway. | ||
Cancer Manag Res siPRDX2-elevated DNM3 inhibits the proliferation and metastasis of colon cancer cells via AKT signaling pathway.
| ||
Oncol Lett PRDX2 protects hepatocellular carcinoma SMMC-7721 cells from oxidative stress. | ||
Cell Death Dis PRDX2 promotes the proliferation of colorectal cancer cells by increasing the ubiquitinated degradation of p53.
| ||
Curr Issues Mol Biol Peroxiredoxins and Hypoxia-Inducible Factor-1α in Duodenal Tissue: Emerging Factors in the Pathophysiology of Pediatric Celiac Disease Patients |












