Validation Data Gallery
Tested Applications
| Positive WB detected in | A549 cells, HEK-293 cells, U2OS cells, HeLa cells, HepG2 cells, mouse kidney tissue, rat kidney tissue |
| Positive IP detected in | HEK-293 cells, mouse kidney tissue |
| Positive IHC detected in | human breast cancer tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 40 publications below |
| IHC | See 8 publications below |
| IF | See 6 publications below |
| IP | See 2 publications below |
| CoIP | See 1 publications below |
Product Information
15816-1-AP targets PRDX1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8602 Product name: Recombinant human PRDX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-199 aa of BC007063 Sequence: MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK 相同性解析による交差性が予測される生物種 |
| Full Name | peroxiredoxin 1 |
| Calculated molecular weight | 199 aa, 22 kDa |
| Observed molecular weight | 23 kDa |
| GenBank accession number | BC007063 |
| Gene Symbol | PRDX1 |
| Gene ID (NCBI) | 5052 |
| RRID | AB_2170318 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q06830 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PRDX1 (Peroxiredoxin-1), also named as PAGA, PAGB, TDPX2, PAG or NKEF-A, belongs to the ahpC/TSA family. PRDX1 is a thiol reductase that plays critical roles in oxidative and thermal stress defense mechanisms through its abilities to metabolize H2O2 and act as a molecular chaperone, respectively. PRDX1 might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2 (PMID: 9497357). It reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation. PRDX1 can form a dimer, and also can be phosphorylated on Thr-90 during the M-phase, which leads to a more than 80% decrease in enzymatic activity (PMID: 22583657, 11986303).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PRDX1 antibody 15816-1-AP | Download protocol |
| IHC protocol for PRDX1 antibody 15816-1-AP | Download protocol |
| IP protocol for PRDX1 antibody 15816-1-AP | Download protocol |
| WB protocol for PRDX1 antibody 15816-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Suppression of mitochondrial ROS by prohibitin drives glioblastoma progression and therapeutic resistance. | ||
Br J Pharmacol Luteolin ameliorates rat myocardial ischemia-reperfusion injury through peroxiredoxin II activation. | ||
Cell Chem Biol Parvifoline AA Promotes Susceptibility of Hepatocarcinoma to Natural Killer Cell-Mediated Cytolysis by Targeting Peroxiredoxin. | ||
Cell Rep The Ets transcription factor GABP is a component of the hippo pathway essential for growth and antioxidant defense. | ||
Elife Hepatic AMPK signaling dynamic activation in response to REDOX balance are sentinel biomarkers of exercise and antioxidant intervention to improve blood glucose control |








