Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293T cells, HeLa cells, mouse brain tissue, mouse skeletal muscle tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human breast cancer tissue, human colon tissue, mouse colon tissue, rat colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, NIH/3T3 cells, A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 4 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
| IP | See 2 publications below |
Product Information
16264-1-AP targets PQBP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9329 Product name: Recombinant human PQBP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-265 aa of BC012358 Sequence: MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD 相同性解析による交差性が予測される生物種 |
| Full Name | polyglutamine binding protein 1 |
| Calculated molecular weight | 265 aa, 30 kDa |
| Observed molecular weight | 30-32 kDa |
| GenBank accession number | BC012358 |
| Gene Symbol | PQBP1 |
| Gene ID (NCBI) | 10084 |
| RRID | AB_10792928 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60828 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PQBP1 (Polyglutamine-binding protein 1) is also named as NPW38 and JM26. PQBP1 senses extrinsic tau 3R/4R proteins by direct interaction and triggers an innate immune response by activating a cyclic GMP-AMP synthase (cGAS)-Stimulator of interferon genes (STING) pathway (PMID: 34782623). PQBP1 is abundantly expressed in the central nervous system during development. PQBP1 is a component of the precatalytic spliceosome (B complex) that is involved in splicing. PQBP1 was predominantly localized in the cell nucleus. PQBP1 is overexpressed in various cancer types including breast cancer, colon cancer, and glioblastoma (PMID: 38342602).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PQBP1 antibody 16264-1-AP | Download protocol |
| IHC protocol for PQBP1 antibody 16264-1-AP | Download protocol |
| IP protocol for PQBP1 antibody 16264-1-AP | Download protocol |
| WB protocol for PQBP1 antibody 16264-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell PQBP1 promotes translational elongation and regulates hippocampal mGluR-LTD by suppressing eEF2 phosphorylation. | ||
Acta Neuropathol Transportin 1 accumulates specifically with FET proteins but no other transportin cargos in FTLD-FUS and is absent in FUS inclusions in ALS with FUS mutations. | ||
Cell Rep Dynamic regulation of alternative polyadenylation by PQBP1 during neurogenesis
| ||
Nat Commun The missense mutation Y65C in PQBP1 causes microcephaly and cognitive deficits through a combination of partial loss-of-function and gain-of-function effects. |














