Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293T cells, human liver tissue, Jurkat cells, MCF-7 cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | mouse liver tissue, rat liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
| Positive FC (Intra) detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 6 publications below |
| WB | See 37 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
| IP | See 6 publications below |
| CoIP | See 1 publications below |
Product Information
13482-1-AP targets PPP2CA in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4294 Product name: Recombinant human PPP2CA protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-309 aa of BC031696 Sequence: MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL 相同性解析による交差性が予測される生物種 |
| Full Name | protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform |
| Calculated molecular weight | 309 aa, 36 kDa |
| Observed molecular weight | 36 kDa |
| GenBank accession number | BC031696 |
| Gene Symbol | PPP2CA |
| Gene ID (NCBI) | 5515 |
| RRID | AB_2169485 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P67775 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PPP2CA, also named as RP-C and PP2A-alpha, belongs to the PPP phosphatase family and PP-1 subfamily. PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. PP2A activity was modestly decreased in AML patients harboring C-KIT/WT.PP2A is a target for C-KIT/TKD and implicated the potential efficacy of therapies targeting PP2A in such AML in future.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PPP2CA antibody 13482-1-AP | Download protocol |
| IHC protocol for PPP2CA antibody 13482-1-AP | Download protocol |
| IP protocol for PPP2CA antibody 13482-1-AP | Download protocol |
| WB protocol for PPP2CA antibody 13482-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Science Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase. | ||
Protein Cell Senktide blocks aberrant RTN3 interactome to retard memory decline and tau pathology in social isolated Alzheimer's disease mice | ||
Cell Res Nuclear UHRF1 is a gate-keeper of cellular AMPK activity and function.
| ||
Acta Pharm Sin B WSB1 regulates c-Myc expression through β-catenin signaling and forms a feedforward circuit. | ||
Cardiovasc Res Role of type 2A phosphatase regulatory subunit B56α in regulating cardiac responses to β-adrenergic stimulation in vivo. | ||
EMBO J The CEP170B-KIF2A complex destabilizes microtubule minus ends to generate polarized microtubule network |











