Validation Data Gallery
Tested Applications
| Positive WB detected in | human brain tissue, NIH/3T3 |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human cervical cancer tissue, human ovary tumor tissue, mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 6 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
Product Information
10140-2-AP targets PPP1CB in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0183 Product name: Recombinant human PPP1CB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-183 aa of BC002697 Sequence: MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSME 相同性解析による交差性が予測される生物種 |
| Full Name | protein phosphatase 1, catalytic subunit, beta isoform |
| Calculated molecular weight | 37 kDa |
| Observed molecular weight | 37 kDa |
| GenBank accession number | BC002697 |
| Gene Symbol | PPP1CB |
| Gene ID (NCBI) | 5500 |
| RRID | AB_2168272 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62140 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Protein phosphatase 1 (PP1) is the main eukaryotic protein serine/threonine phosphatase that regulates an enormous variety of cellular processes including protein-protein interactions, gene transcription, cell-cycle progression and apoptosis. It is a trimeric complex composed of a regulatory subunit, a variable subunit and a catalytic subunit. The catalytic subunit of PP1 (PP1c) can interact with amount of regulatory subunits in vivo that target it to particular subcellular locations and regulate its activity towards specific substrates. PPP1CB migrated as a 37kd protein on SDS page. This antibody is specific to PPP1CB.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PPP1CB antibody 10140-2-AP | Download protocol |
| IP protocol for PPP1CB antibody 10140-2-AP | Download protocol |
| WB protocol for PPP1CB antibody 10140-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Am J Physiol Cell Physiol PP1γ functionally augments the alternative splicing of CaMKIIδ through interacting with ASF. | ||
Melanoma Res Differential expression patterns of capping protein, protein phosphatase 1, and casein kinase 1 may serve as diagnostic markers for malignant melanoma. | ||
Clin Exp Pharmacol Physiol Rescue of cardiac failing and remodeling by inhibition of PP1γ is associated with suppression of the ASF-mediated splicing of CaMKIIδ | ||
J Exp Clin Cancer Res Non-canonical activation of MAPK signaling by the lncRNA ASH1L-AS1-encoded microprotein APPLE through inhibition of PP1/PP2A-mediated ERK1/2 dephosphorylation in hepatocellular carcinoma | ||
Comput Struct Biotechnol J Alternative polyadenylation regulates the translation of metabolic and inflammation-related proteins in adipose tissue of gestational diabetes mellitus | ||
Adv Sci (Weinh) Histones Methyltransferase NSD3 Inhibits Lung Adenocarcinoma Glycolysis Through Interacting with PPP1CB to Decrease STAT3 Signaling Pathway |









