Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, human heart tissue, rat heart tissue, mouse heart tissue |
| Positive IP detected in | mouse heart tissue |
| Positive IHC detected in | human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 12 publications below |
| IHC | See 1 publications below |
| IF | See 5 publications below |
| IP | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
18466-1-AP targets PPIF in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13151 Product name: Recombinant human PPIF-Specific protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-207 aa of BC005020 Sequence: MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS 相同性解析による交差性が予測される生物種 |
| Full Name | peptidylprolyl isomerase F |
| Calculated molecular weight | 22 kDa |
| Observed molecular weight | 16~22 kDa |
| GenBank accession number | BC005020 |
| Gene Symbol | PPIF |
| Gene ID (NCBI) | 10105 |
| RRID | AB_2169273 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P30405 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PPIF, also named as Cyclophilin D (CypD), CYP3, PPIase F and Rotamase F, belongs to the cyclophilin-type PPIase family. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIF is a mitochondrial matrix protein involved in the induction of necrotic and apoptotic cell death through the activation of the mitochondrial permeability transition (mPT) pore. This antibody is immunized with full length gene PPIF and absorbed by PPIA. So this antibody is specific to PPIF.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PPIF antibody 18466-1-AP | Download protocol |
| IHC protocol for PPIF antibody 18466-1-AP | Download protocol |
| IP protocol for PPIF antibody 18466-1-AP | Download protocol |
| WB protocol for PPIF antibody 18466-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun The mitochondrial fusion protein OPA1 is dispensable in the liver and its absence induces mitohormesis to protect liver from drug-induced injury | ||
Aging (Albany NY) Overexpression of TICRR and PPIF confer poor prognosis in endometrial cancer identified by gene co-expression network analysis. | ||
J Biol Chem The short variant of optic atrophy 1 (OPA1) improves cell survival under oxidative stress. | ||
Cell Signal Diminution of HSP75 disrupts intestinal epithelial barrier by inciting mPTP opening in ulcerative colitis | ||
Nat Nanotechnol An orally administered gene editing nanoparticle boosts chemo-immunotherapy in colorectal cancer |










