Validation Data Gallery
Tested Applications
| Positive IHC detected in | human colon tissue, human breast cancer tissue, human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IHC | See 11 publications below |
| IF | See 22 publications below |
Product Information
19899-1-AP targets Periostin in IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13791 Product name: Recombinant human POSTN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 21-368 aa of BC106710 Sequence: ANNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTCKNWYKKSICGQKTTVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEALMKYHILNTLQCSESIMGGAVFETLEGNTIEIGCDGDSITVNGIKMVNKKDIVTNNGVIHLIDQVLIPD 相同性解析による交差性が予測される生物種 |
| Full Name | periostin, osteoblast specific factor |
| Calculated molecular weight | 93 kDa |
| GenBank accession number | BC106710 |
| Gene Symbol | Periostin |
| Gene ID (NCBI) | 10631 |
| RRID | AB_10732682 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15063 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Periostin (POSTN, PN), originally named as osteoblast-specific factor 2 (OSF-2), is a 90-kDa secreted protein which is now classified as a matricellular protein. It is present in a wide variety of normal adult tissues and fetal tissues, and has a role in bone, tooth and heart development and function. Studies show that periostin is overexpressed in a broad range of human cancer types, including lung, ovary, breast and colon cancers. Recent evidence reveals that periostin is expressed by fibroblasts in the normal tissue and in the stroma of the primary tumour, and it is required to allow cancer stem cell maintenance. The isoforms of periostin are between 83 and 93 kDa in mass and differ in their C-terminal sequences, characterized by individual presence or absence of cassette exons 17-21 (UniProtKB/Swiss-Prot,PMID: 21997759).
Publications
| Species | Application | Title |
|---|---|---|
Clin Exp Hypertens Nuclear receptor subfamily 1 group D member 1 suppresses the proliferation, migration of adventitial fibroblasts, and vascular intimal hyperplasia via mammalian target of rapamycin complex 1/β-catenin pathway | ||
Matrix Biol Proteome-wide and matrisome-specific atlas of the human ovary computes fertility biomarker candidates and open the way for precision oncofertility. | ||
Antioxidants (Basel) MicroRNA-4732-3p Is Dysregulated in Breast Cancer Patients with Cardiotoxicity, and Its Therapeutic Delivery Protects the Heart from Doxorubicin-Induced Oxidative Stress in Rats | ||
J Nanobiotechnology Graphene quantum dots rescue angiogenic retinopathy via blocking STAT3/Periostin/ERK signaling. | ||
Cell Death Dis Periostin secreted by cancer-associated fibroblasts promotes cancer stemness in head and neck cancer by activating protein tyrosine kinase 7. | ||
Stem Cell Res Ther Adipose-derived stromal/stem cells are verified to be potential seed candidates for bio-root regeneration in three-dimensional culture. |





