Validation Data Gallery
Tested Applications
| Positive WB detected in | COLO 320 cells, mouse colon tissue, HeLa cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U-251 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 6 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
10997-2-AP targets POLG2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1424 Product name: Recombinant human POLG2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 136-485 aa of BC009194 Sequence: GPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPAYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV 相同性解析による交差性が予測される生物種 |
| Full Name | polymerase (DNA directed), gamma 2, accessory subunit |
| Calculated molecular weight | 55 kDa |
| Observed molecular weight | 55 kDa |
| GenBank accession number | BC009194 |
| Gene Symbol | POLG2 |
| Gene ID (NCBI) | 11232 |
| RRID | AB_2299887 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UHN1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
mtDNA is replicated by DNA polymerase gamma, which is composed of a catalytic (encoded by POLG) and an accessory subunit (encoded by POLG2). POLG2(DNA polymerase subunit gamma-2, mitochondrial) can stimulate the polymerase and exonuclease activities (PMID: 37085601). Defects in POLG2 are the cause of progressive external ophthalmoplegia with mitochondrial DNA deletions autosomal dominant type 4 (PEOA4) (PMID: 16685652).Western blot result suggested that the POLG2 expressed in human fetal kidney and U-251 MG cell lines with a single band of 55kd.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for POLG2 antibody 10997-2-AP | Download protocol |
| IHC protocol for POLG2 antibody 10997-2-AP | Download protocol |
| WB protocol for POLG2 antibody 10997-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Acta Pharm Sin B Miriplatin-loaded liposome, as a novel mitophagy inducer, suppresses pancreatic cancer proliferation through blocking POLG and TFAM-mediated mtDNA replication | ||
Biochim Biophys Acta Mol Cell Res TFB2M and POLRMT are essential for mammalian mitochondrial DNA replication | ||
Mitochondrion The accessory subunit of human DNA polymerase γ is required for mitochondrial DNA maintenance and is able to stabilize the catalytic subunit.
| ||
Nat Cell Biol Mitochondrial DNA replication stress triggers a pro-inflammatory endosomal pathway of nucleoid disposal | ||
PLoS One Interference with mitochondrial metabolism could serve as a potential therapeutic strategy for advanced prostate cancer |




