Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse pancreas tissue, BxPC-3 cells, human pancreas tissue, rat pancreas tissue |
| Positive IHC detected in | mouse pancreas tissue, human pancreas cancer tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IHC | See 2 publications below |
Product Information
11209-1-AP targets Pancreatic Lipase in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1681 Product name: Recombinant human PNLIP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 116-465 aa of BC014309 Sequence: VNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGHLDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGFPCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWYNNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC 相同性解析による交差性が予測される生物種 |
| Full Name | pancreatic lipase |
| Calculated molecular weight | 52 kDa |
| Observed molecular weight | 48-52 kDa |
| GenBank accession number | BC014309 |
| Gene Symbol | Pancreatic Lipase |
| Gene ID (NCBI) | 5406 |
| RRID | AB_2167443 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P16233 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The pancreatic triacylglycerol lipase precursor (PNLIP), a 56 kDa protein secreted by the pancreas that is essential for the hydrolysis and absorption of long-chain triglyceride fatty acids in the intestine is located ~1 Mb upstream from the chromosome 10 peak(PMID:17890784). It is also named as PL, PTL and belongs to the AB hydrolase superfamily. It may potentially be involved in the pathophysiology of traumatic brain injury and may be implicated in the proliferation of astrocytes and the recovery of neurological outcomes(PMID:19760487). The full length protein has a signal peptide with 16 amino acid and a glycosylation site.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Pancreatic Lipase antibody 11209-1-AP | Download protocol |
| WB protocol for Pancreatic Lipase antibody 11209-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int J Mol Sci Blocking β₁/β₂-Adrenergic Signaling Reduces Dietary Fat Absorption by Suppressing Expression of Pancreatic Lipase in High Fat-Fed Mice. | ||
JPEN J Parenter Enteral Nutr Early Enteral Administration of a Complex Lipid Emulsion Supplement Prevents Postnatal Deficits in Docosahexaenoic and Arachidonic Acids and Increases Tissue Accretion of Lipophilic Nutrients in Preterm Piglets. | ||
Phytomedicine Qingyi decoction and its active ingredients ameliorate acute pancreatitis by regulating acinar cells and macrophages via NF-κB/NLRP3/Caspase-1 pathways | ||
Am J Cancer Res A human pan-cancer system analysis of heat shock protein family A member 5 | ||
United European Gastroenterol J Remote Pancreatic Response to Severe Polytrauma Correlates With Clinical Outcome. | ||
J Adv Res Inflammation-driven biomimetic nano-polyphenol drug delivery system alleviates severe acute pancreatitis by inhibiting macrophage PANoptosis and pancreatic enzymes oversecretion |







