Validation Data Gallery
Tested Applications
Positive WB detected in | HEK-293 cells, HeLa cells, MCF-7 cells, SH-SY5Y cells, PC-12 cells |
Positive IHC detected in | human lung cancer tissue, human colon cancer tissue, human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 27 publications below |
IHC | See 5 publications below |
Product Information
67121-1-Ig targets PI3 Kinase p110 Beta in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples.
Tested Reactivity | human, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag17505 Product name: Recombinant human PIK3CB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 139-373 aa of BC114432 Sequence: SLKDPEVNEFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRALPHFILVECCKIKKMYEQEMIAIEAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHGTELLCKTIVSSEV 相同性解析による交差性が予測される生物種 |
Full Name | phosphoinositide-3-kinase, catalytic, beta polypeptide |
Calculated molecular weight | 1070 aa, 123 kDa |
Observed molecular weight | 120-130 kDa |
GenBank accession number | BC114432 |
Gene Symbol | PI3 Kinase p110 Beta |
Gene ID (NCBI) | 5291 |
RRID | AB_2882424 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P42338 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PIK3CB(phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform) is also named as PIK3C1, PI3K-beta, p110beta. The gene encodes a 1070 amino acid protein which belongs to the PI3/PI4-kinase family. Phosphoinositide 3-kinases (PI3Ks) have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. The class I PI3 kinases are heterodimers composed of 110 kDa catalytic subunits that associate with regulatory adaptor proteins. Four class I catalytic subunits have been identified, PIK3CA (p110α), PIK3CB (p110β), PIK3CD (p110δ) and PIK3CG (p110γ)(PMID:19177002).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PI3 Kinase p110 Beta antibody 67121-1-Ig | Download protocol |
IHC protocol for PI3 Kinase p110 Beta antibody 67121-1-Ig | Download protocol |
IF protocol for PI3 Kinase p110 Beta antibody 67121-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Metab Maternal exercise prevents metabolic disorders in offspring mice through SERPINA3C | ||
J Med Chem Discovery of Novel Phosphoinositide-3-Kinase α Inhibitors with High Selectivity, Excellent Bioavailability, and Long-Acting Efficacy for Gastric Cancer. | ||
J Ethnopharmacol Antitumor mechanism of kangliu pill on gliomas in mice through PI3K-Akt signaling pathway | ||
Front Oncol Relationship Between PTEN and Angiogenesis of Esophageal Squamous Cell Carcinoma and the Underlying Mechanism. | ||
Bioorg Chem Design, synthesis and biological evaluation of anilide (dicarboxylic acid) shikonin esters as antitumor agents through targeting PI3K/Akt/mTOR signaling pathway. | ||
Chin Med Integrated metabolomics, network pharmacology and biological verification to reveal the mechanisms of Nauclea officinalis treatment of LPS-induced acute lung injury |