Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, Hepa1-6 cells, HepG2 cells, hTERT-RPE1 cells, WB result of Piezo1 (extracellular domain) antibody (28511-1-AP; 1:600; room temperature for 1.5 hours) with wild-type and Piezo1 (extracellular domain) knockout Hepa 1-6 cells. |
| Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 7 publications below |
| WB | See 14 publications below |
| IHC | See 3 publications below |
| IF | See 10 publications below |
| IP | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
28511-1-AP targets Piezo1 (extracellular domain) in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29858 Product name: Recombinant human FAM38A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 108-294 aa of BC008073 Sequence: YEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPMVIFSDK 相同性解析による交差性が予測される生物種 |
| Full Name | family with sequence similarity 38, member A |
| Calculated molecular weight | 286 kDa |
| Observed molecular weight | 280-300 kDa |
| GenBank accession number | BC008073 |
| Gene Symbol | Piezo1/FAM38A |
| Gene ID (NCBI) | 9780 |
| RRID | AB_2881161 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92508 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Mechanotransduction, the conversion of mechanical force into biological signals, is a fundamental physiologic process of mammalian cells which influences many critical processes including embryonic development, tactile, pain, and auditory sensation, regulation of vascular tone, flow sensing in the kidney, and muscle and tendon stretch. FAM38A, also known as PIEZO1, has recently been identified as a mechanotransduction protein that gets involved in mechanosensation and stretch-activated cation channel activation. Fam38A also plays a key role in epithelial cell adhesion by maintaining integrin activation through R-Ras recruitment to the ER. Mutations in gene encoding PIEZO1 are associated with hereditary xerocytosis. Piezo1 also regulates extrusion to maintain homeostatic epithelial cell numbers. This antibody was raised against the extracellular domain of human Piezo1.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Piezo1 (extracellular domain) antibody 28511-1-AP | Download protocol |
| IHC protocol for Piezo1 (extracellular domain) antibody 28511-1-AP | Download protocol |
| WB protocol for Piezo1 (extracellular domain) antibody 28511-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Glia Mechanosensitive channel Piezo1 is an essential regulator in cell cycle progression of optic nerve head astrocytes
| ||
FASEB J Mechanical stretch activates piezo1 in caveolae of alveolar type I cells to trigger ATP release and paracrine stimulation of surfactant secretion from alveolar type II cells.
| ||
J Adv Res Kaempferol regulating macrophage foaming and atherosclerosis through piezo1-mediated MAPK/NF-κB and Nrf2/HO-1 signaling pathway | ||
Acta Biomater PIEZO1-Mediated Mechanotransduction Regulates Collagen Synthesis on Nanostructured 2D and 3D Models of Fibrosis | ||
Mol Neurobiol Exosomal circZNF800 Derived from Glioma Stem-like Cells Regulates Glioblastoma Tumorigenicity via the PIEZO1/Akt Axis
|






