Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse heart tissue, HeLa cells, mouse skeletal muscle tissue, rat heart tisssue, rat skeletal muscle tissue |
| Positive IHC detected in | human breast cancer tissue, mouse skeletal muscle tissue, mouse heart tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 7 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
Product Information
15550-1-AP targets PGAM2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7908 Product name: Recombinant human PGAM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-253 aa of BC001904 Sequence: MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTIARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVYELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK 相同性解析による交差性が予測される生物種 |
| Full Name | phosphoglycerate mutase 2 (muscle) |
| Calculated molecular weight | 29 kDa |
| Observed molecular weight | 29 kDa |
| GenBank accession number | BC001904 |
| Gene Symbol | PGAM2 |
| Gene ID (NCBI) | 5224 |
| RRID | AB_2299336 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P15259 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Phosphoglycerate mutase (PGAM), an important enzyme in the glycolytic pathway, catalyzes the transfer of a phosphate group between the 2 and the 3 positions of glyceric acid. The muscle-specific isoform (type M, PGAM2) of phosphoglycerate mutase (PGAM) is a housekeeping enzyme and it catalyzes the conversion of 3-phosphoglycerate into 2-phosphoglycerate in the glycolysis process to release energy. It is encoded by the Pgam2 gene. In addition, it is demonstrated that PGAM2 locates both in cytoplasm and nuclei, and takes part in the glycometabolism process of cytoplasm and nuclei(PMID: 18499067). Defects in PGAM2 are the cause of glycogen storage disease type 10 (GSD10). This antibody may also recognize PGAM1 and PGAM4 due to the high homology.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PGAM2 antibody 15550-1-AP | Download protocol |
| WB protocol for PGAM2 antibody 15550-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
EMBO Rep METTL14 modulates glycolysis to inhibit colorectal tumorigenesis in p53-wild-type cells | ||
Sci Rep Proteomic analysis indicates that mitochondrial energy metabolism in skeletal muscle tissue is negatively correlated with feed efficiency in pigs. | ||
J Proteomics Proteomics analysis of asthenozoospermia and identification of glucose-6-phosphate isomerase as an important enzyme for sperm motility. | ||
Anim Biosci Effect of cholesterol-loaded cyclodextrin treatment on boar sperm cryopreservation | ||
Cell Res Low glucose metabolite 3-phosphoglycerate switches PHGDH from serine synthesis to p53 activation to control cell fate | ||
Redox Biol Unbalanced redox status network as an early pathological event in congenital cataracts |










