Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse heart tissue, HEK-293 cells, NIH/3T3 cells, mouse liver tissue, rat liver tissue |
| Positive IP detected in | SiHa cells |
| Positive IHC detected in | human liver cancer tissue, human heart tissue, human kidney tissue, human breast cancer tissue, mouse kidney tissue, rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 38 publications below |
| IHC | See 11 publications below |
| IF | See 4 publications below |
Product Information
18262-1-AP targets PDK1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13121 Product name: Recombinant human PDK1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-436 aa of BC039158 Sequence: MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA 相同性解析による交差性が予測される生物種 |
| Full Name | pyruvate dehydrogenase kinase, isozyme 1 |
| Calculated molecular weight | 436 aa, 49 kDa |
| Observed molecular weight | 46-55 kDa |
| GenBank accession number | BC039158 |
| Gene Symbol | PDK1 |
| Gene ID (NCBI) | 5163 |
| RRID | AB_10598310 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15118 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PDK1(pyruvate dehydrogenase kinase isoform 1) is also named as PDHK1 and belongs to the PDK/BCKDK protein kinase family. It inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism (PMID:17683942). Starvation increases islet PDK activity (PMID:11723055). PDK1 has 2 isoforms with the MW of 49 and 52 kD, and a 28aa-transit-peptide in the N-terminal can be removed in the mature form. This antibody is specific to PDK1.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PDK1 antibody 18262-1-AP | Download protocol |
| IP protocol for PDK1 antibody 18262-1-AP | Download protocol |
| WB protocol for PDK1 antibody 18262-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cardiovasc Res Inhibition of PGK1 attenuates autoimmune myocarditis by reprogramming CD4+ T cells metabolism | ||
Cell Death Dis Pyruvate dehydrogenase kinase 1 protects against neuronal injury and memory loss in mouse models of diabetes | ||
Bioact Mater Polydopamine-mediated graphene oxide and nanohydroxyapatite-incorporated conductive scaffold with an immunomodulatory ability accelerates periodontal bone regeneration in diabetes. | ||
Cancer Lett PINK1 deficiency in gastric cancer compromises mitophagy, promotes the Warburg effect, and facilitates M2 polarization of macrophages. | ||
Redox Biol Impairment of Akt activity by CYP2E1 mediated oxidative stress is involved in chronic ethanol-induced fatty liver. |















