Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, MCF-7 cells, rat brain tissue | 
| Positive IP detected in | mouse brain tissue | 
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF-P detected in | human breast cancer tissue | 
| Positive IF/ICC detected in | BxPC-3 cells, HeLa cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 13 publications below | 
| WB | See 42 publications below | 
| IHC | See 14 publications below | 
| IF | See 21 publications below | 
| CoIP | See 1 publications below | 
Product Information
12110-1-AP targets PADI2 in WB, IHC, IF/ICC, IF-P, IP, COIP, ELISA, Blocking assay applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat, pig, canine | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag2755 Product name: Recombinant human PADI2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 118-438 aa of BC009701 Sequence: ISLDVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVNGKTYPLGRILIGSSFPL 相同性解析による交差性が予測される生物種 | 
                                    
| Full Name | peptidyl arginine deiminase, type II | 
| Calculated molecular weight | 665 aa, 75 kDa | 
| Observed molecular weight | 70-75 kDa, 50 kDa | 
| GenBank accession number | BC009701 | 
| Gene Symbol | PADI2 | 
| Gene ID (NCBI) | 11240 | 
| RRID | AB_2159475 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q9Y2J8 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
PADI2, also named as KIAA0994, PDI2, PAD-H19, and PAD2(Peptidylarginine deiminase II ), belongs to the protein arginine deiminase family. It catalyzes the deimination of arginine residues of proteins. PADI2 may play a regulatory role in the expression of lactation-related genes via histone citrullination during diestrus (PMID:20668670). PADI2 has two isoforms with MW 75 kDa and 49 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PADI2 antibody 12110-1-AP | Download protocol | 
| IHC protocol for PADI2 antibody 12110-1-AP | Download protocol | 
| IP protocol for PADI2 antibody 12110-1-AP | Download protocol | 
| WB protocol for PADI2 antibody 12110-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Sci Transl Med Neutrophil extracellular traps, B cells, and type I interferons contribute to immune dysregulation in hidradenitis suppurativa. | ||
Mol Cell Arginine Citrullination at the C-Terminal Domain Controls RNA Polymerase II Transcription.
  | ||
J Immunother Cancer PAD-2-mediated citrullination of nucleophosmin provides an effective target for tumor immunotherapy.
  | ||
Angiogenesis Angiogenic responses in a 3D micro-engineered environment of primary endothelial cells and pericytes.
  | ||
Proc Natl Acad Sci U S A Peptidylarginine deiminase 2-catalyzed histone H3 arginine 26 citrullination facilitates estrogen receptor α target gene activation. | ||
Diabetes Modifying Enzymes are Elicited by ER Stress, Generating Epitopes that are Selectively Recognized by CD4+ T Cells in Patients With Type 1 Diabetes. | 








