Validation Data Gallery
Tested Applications
| Positive WB detected in | SiHa cells, HEK-293 cells, HeLa cells, TF-1 cells |
| Positive IHC detected in | human rectal cancer tissue, Human Breast Cancer(Her2+;ER-;PR-), human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IHC | See 2 publications below |
| IF | See 2 publications below |
Product Information
60626-1-Ig targets CDKN2A/P16-INK4A in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1328 Product name: Recombinant human P16-INK4A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 52-156 aa of BC021998 Sequence: MMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD 相同性解析による交差性が予測される生物種 |
| Full Name | cyclin-dependent kinase inhibitor 2A |
| Calculated molecular weight | 16 kDa |
| Observed molecular weight | 16 kDa |
| GenBank accession number | BC021998 |
| Gene Symbol | CDKN2A |
| Gene ID (NCBI) | 1029 |
| RRID | AB_3670270 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P42771 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
P16-INK4A is also named as CDKN2A, MLM, Tumor suppressor ARF, Alternative reading frame. The tumor suppressor protein p16Ink4a (encoded from the CDKN2A locus) is often transcriptionally activated in cells undergoing senescence and is one of the main regulators of this program, and it is upregulated in multiple tissues during aging (PMID:17055429). p16-Ink4a is the principal member of the Ink4 family of CDK inhibitors. p16-Ink4a contributes to the regulation of cell cycle progression by inhibiting the S phase. p16Ink4a binds to CDK4/6, inhibiting cyclin D-CDK4/6 complex formation and CDK4/6-mediated phosphorylation of Rb family members. Expression of p16-Ink4a maintains the Rb family members in a hypophosphorylated state, which promotes binding to E2F1 and leads to G1 cell cycle arrest (PMID: 21297668).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CDKN2A/P16-INK4A antibody 60626-1-Ig | Download protocol |
| WB protocol for CDKN2A/P16-INK4A antibody 60626-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Aging Single-cell and spatial RNA sequencing identify divergent microenvironments and progression signatures in early- versus late-onset prostate cancer | ||
iScience Virus-host interactome reveals host cellular pathways perturbed by tick-borne encephalitis virus infection. | ||
Cell Signal The anti-aging drug Senolytics alleviates vascular endothelial cell senescence by antagonizing the JPX-BRD4-p65 complex. | ||
Int Immunopharmacol Development and In vitro antitumor evaluation of a novel anti-p16 antibody fragment-drug conjugate. | ||
Reproduction TMEM119 links to ovarian endometriosis progression via MAPK-mediated suppression of ectopic endometrial stromal cell senescence. | ||
Hum Vaccin Immunother Nanovaccine loaded with seno-antigen target senescent cells to improve metabolic disorders of adipose tissue and cardiac dysfunction |



















