Validation Data Gallery
Tested Applications
Positive WB detected in | mouse liver tissue, mouse bladder tissue |
Positive IP detected in | human plasma tissue |
Positive IHC detected in | human liver tissue, human normal colon, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 11 publications below |
IHC | See 4 publications below |
IF | See 2 publications below |
ELISA | See 1 publications below |
CoIP | See 1 publications below |
Product Information
16439-1-AP targets ORM1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag9758 Product name: Recombinant human ORM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-201 aa of BC026238 Sequence: NLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES 相同性解析による交差性が予測される生物種 |
Full Name | orosomucoid 1 |
Calculated molecular weight | 201 aa, 24 kDa |
Observed molecular weight | 40-47 kDa |
GenBank accession number | BC026238 |
Gene Symbol | ORM1 |
Gene ID (NCBI) | 5004 |
RRID | AB_2878259 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P02763 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Alpha-1-acid glycoprotein 1 (AGP1), also called orosomucoid-1 (ORM1), is a glycoprotein synthesized mostly by hepatocytes and present in human plasma. ORM1 is an acute-phase reactant protein controlled by glucocorticoids, interleukin-1 and interleukin-6, and increase up to 5-50 times upon infection and/or inflammation. Anti-apoptotic effect and role as immunomodulator of ORM have been reported. ORM is an important carrier for synthetic drugs and influences their distribution and availability in the body. This antibody recognizes a band about 44 kDa in human plasma which may be due to the glycosylation of ORM1 or the dimer formation of the protein.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ORM1 antibody 16439-1-AP | Download protocol |
IHC protocol for ORM1 antibody 16439-1-AP | Download protocol |
IF protocol for ORM1 antibody 16439-1-AP | Download protocol |
IP protocol for ORM1 antibody 16439-1-AP | Download protocol |
FC protocol for ORM1 antibody 16439-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Commun The RNA-binding protein vigilin regulates VLDL secretion through modulation of Apob mRNA translation. | ||
Mol Pharm Contribution of the α1-Acid Glycoprotein in Drug Pharmacokinetics: The Usefulness of α1-Acid Glycoprotein-Knockout Mice | ||
Br J Cancer Identification of GlcNAcylated alpha-1-antichymotrypsin as an early biomarker in human non-small-cell lung cancer by quantitative proteomic analysis with two lectins. | ||
Sci Rep An acute phase protein α1-acid glycoprotein mitigates AKI and its progression to CKD through its anti-inflammatory action. | ||
Diagnostics (Basel) Urine Proteome in Distinguishing Hepatic Steatosis in Patients with Metabolic-Associated Fatty Liver Disease. |