Validation Data Gallery
Tested Applications
| Positive WB detected in | bEnd.3 cells, human liver tissue |
| Positive IP detected in | L02 cells |
| Positive IHC detected in | human heart tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 32 publications below |
| IHC | See 13 publications below |
| IF | See 12 publications below |
| CoIP | See 1 publications below |
Product Information
11837-1-AP targets OLR1/LOX1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2437 Product name: Recombinant human OLR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-273 aa of BC022295 Sequence: MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ 相同性解析による交差性が予測される生物種 |
| Full Name | oxidized low density lipoprotein (lectin-like) receptor 1 |
| Calculated molecular weight | 273 aa, 31 kDa |
| Observed molecular weight | 50-55 kDa |
| GenBank accession number | BC022295 |
| Gene Symbol | OLR1 |
| Gene ID (NCBI) | 4973 |
| RRID | AB_2299037 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P78380 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
OLR1/LOX-1 acts as a receptor, in the form of homodimer, that mediates the recognition, internalization, and degradation of oxidatively modified low density lipoprotein (oxLDL) (PMID: 9052782, 15695803). ORL1 is predominantly expressed in endothelial cells and vascular-rich organs such as the placenta, lung, liver, and brain (PMID: 9828121). OLR1 is a protein containing 273 amino acids with a calculated molecular mass of 31 kDa but an apparent molecular mass of 50 kDa, which may result from the glycosylation of four potential N-linked glycosylation sites located at the C-terminal domain (PMID: 9052782).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for OLR1/LOX1 antibody 11837-1-AP | Download protocol |
| IP protocol for OLR1/LOX1 antibody 11837-1-AP | Download protocol |
| WB protocol for OLR1/LOX1 antibody 11837-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Free Radic Biol Med Up-regulation of thioredoxin system by puerarin inhibits lipid uptake in macrophages | ||
Cancer Lett Up-regulation of OLR1 expression by TBC1D3 through activation of TNFα/NF-κB pathway promotes the migration of human breast cancer cells.
| ||
Metabolism Deacetylation of Caveolin-1 by Sirt6 induces autophagy and retards high glucose-stimulated LDL transcytosis and atherosclerosis formation. | ||
Sci Rep Lectin-like oxidized low-density lipoprotein receptor-1 facilitates metastasis of gastric cancer through driving epithelial-mesenchymal transition and PI3K/Akt/GSK3β activation.
| ||
Int J Cancer The oxidized-LDL/LOX-1 axis in tumor endothelial cells enhances metastasis by recruiting neutrophils and cancer cells. | ||
Mol Cancer Res OLR1 Promotes Pancreatic Cancer Metastasis via Increased c-Myc Expression and Transcription of HMGA2.
|





