Recombinant human NeuN protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag19347
Synonyms
FLJ56884; FLJ58356; FOX3; HRNBP3
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MTECAPGLGIRDGVTKSLVDDGEVARGFADGQPCPAATPLGLFLVRSLNNLKSQQPEEILPPFSQVCSPSSWEPAPGAIPLQTESPECLGENWLNKRYKDFLYFS
(1-105 aa encoded by BC093713) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
















