Validation Data Gallery
Tested Applications
| Positive WB detected in | COLO 320 cells, Jurkat cells, HeLa cells, K-562 cells, MCF-7 cells |
| Positive IP detected in | COLO 320 cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IF | See 3 publications below |
Product Information
12329-1-AP targets NUP98-NUP96 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3016 Product name: Recombinant human NUP98-NUP96 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1515-1817 aa of BC012906 Sequence: TADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEGLWEWAIFVLLHIDNSGIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEALCLFKAEHWNRCHKLIIRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKDRLAQSDMAKRVANLLRVVLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDELRSLTQSYLRELAVGSL 相同性解析による交差性が予測される生物種 |
| Full Name | nucleoporin 98kDa |
| Calculated molecular weight | 98 kDa |
| Observed molecular weight | 105 kDa |
| GenBank accession number | BC012906 |
| Gene Symbol | NUP98 |
| Gene ID (NCBI) | 4928 |
| RRID | AB_10973678 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P52948 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Nup98-Nup96 (also known as Nup196, ADIR2 or ADAR2), encoded by NUP98 gene, is a component of the nuclear pore complex (NPC) . It is first synthesized as 186-198 kDa Nup98-Nup96 precursors and the precursors shortly undergo autoproteolysis to give rise to two nucleoporins, the amino-terminal Nup98 (Nup98-N) and carboxy-terminal Nup96 (Nup96-C). Both of Nup98 and Nup96 are localized to the nucleoplasmic side of the NPC. This antibody was raised against the carboxy-terminal region of Nup98-Nup96, it recognizes all Nup98-Nup96 proteins except Nup98-N. Since the autoproteolysis is very rapid this antibody usually detected 98-115 kDa Nup96 protein in multiple cell lines. It is notable that RNA-editing deaminase 1 (Gene ID: 104), also named ADAR2, is a different protein from Nup98-Nup96 (ADAR2).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NUP98-NUP96 antibody 12329-1-AP | Download protocol |
| IHC protocol for NUP98-NUP96 antibody 12329-1-AP | Download protocol |
| IP protocol for NUP98-NUP96 antibody 12329-1-AP | Download protocol |
| WB protocol for NUP98-NUP96 antibody 12329-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Neuron Nucleoporin Seh1 Interacts with Olig2/Brd7 to Promote Oligodendrocyte Differentiation and Myelination. | ||
Cell Rep Antiviral Immune Response as a Trigger of FUS Proteinopathy in Amyotrophic Lateral Sclerosis. | ||
Nat Commun iU-ExM: nanoscopy of organelles and tissues with iterative ultrastructure expansion microscopy | ||
Int J Biol Macromol Subcellular proteomics reveals the crosstalk between nucleocytoplasmic trafficking and the innate immune response to Senecavirus A infection | ||
Biomed Opt Express Maximising imaging volumes of expanded tissues for inverted fluorescence microscopy. |









