Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, mouse brain tissue, rat brain tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 7 publications below |
| IHC | See 2 publications below |
| IF | See 2 publications below |
| CoIP | See 1 publications below |
Product Information
24858-1-AP targets NRBF2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21403 Product name: Recombinant human NRBF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-287 aa of BC001345 Sequence: MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN 相同性解析による交差性が予測される生物種 |
| Full Name | nuclear receptor binding factor 2 |
| Calculated molecular weight | 32 kDa |
| Observed molecular weight | 35-37 kDa |
| GenBank accession number | BC001345 |
| Gene Symbol | NRBF2 |
| Gene ID (NCBI) | 29982 |
| RRID | AB_2879759 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96F24 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
NRBF2 also termed as Nuclear receptor-binding factor 2or COPR is a 287 amino acid protein, which Interacts with PPARA, PPARD and PPARG. NRBF2 as transcription activator may modulate transcriptional activation by target nuclear receptors. NRBF2 is expressed in keratinocytes, liver and placenta. NRBF2, which exists as two isoforms due to alternative splicing, is localized to both the nucleus and the cytoplasm.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NRBF2 antibody 24858-1-AP | Download protocol |
| IHC protocol for NRBF2 antibody 24858-1-AP | Download protocol |
| IP protocol for NRBF2 antibody 24858-1-AP | Download protocol |
| WB protocol for NRBF2 antibody 24858-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Autophagy The mammalian actin elongation factor ENAH/MENA contributes to autophagosome formation via its actin regulatory function | ||
J Neuroinflammation Autophagy protein NRBF2 attenuates endoplasmic reticulum stress-associated neuroinflammation and oxidative stress via promoting autophagosome maturation by interacting with Rab7 after SAH.
| ||
iScience NRBF2 regulates the chemoresistance of small cell lung cancer by interacting with the P62 protein in the autophagy process.
| ||
Lab Invest Nuclear receptor binding factor 2 (NRBF2) is required for learning and memory. | ||
Nat Struct Mol Biol Reduction of DHHC5-mediated beclin 1 S-palmitoylation underlies autophagy decline in aging | ||
NPJ Parkinsons Dis Deficiency of Perry syndrome-associated p150Glued in midbrain dopaminergic neurons leads to progressive neurodegeneration and endoplasmic reticulum abnormalities |





