Validation Data Gallery
Tested Applications
| Positive WB detected in | Jurkat cells, Ramos cells, Daudi cells, HT-29 cells, Raji cells |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 5 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
66878-1-Ig targets Nurr1/NR4A2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1418 Product name: Recombinant human NR4A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 250-598 aa of BC009288 Sequence: SPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF 相同性解析による交差性が予測される生物種 |
| Full Name | nuclear receptor subfamily 4, group A, member 2 |
| Calculated molecular weight | 66 kDa |
| Observed molecular weight | 67 kDa |
| GenBank accession number | BC009288 |
| Gene Symbol | Nurr1 |
| Gene ID (NCBI) | 4929 |
| RRID | AB_2882211 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P43354 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
NR4A2 belongs to the orphan nuclear receptor (NR) family referred to as NR4A family, which have been implicated in cell cycle regulation, apoptosis, inflammation, metabolism and more recently in carcinogenesis [PMID:22583411]. NR4A2 also has a role in the expression of several proteins that are necessary for the synthesis and regulation of DA, such as tyrosine hidroxilase, DA transporter, vesicular monoamine transporter 2, and cRET [PMID:22294735]. Act as a transcriptional regulator, NR4A2 is essential for the differentiation and maintenance of meso-diencephalic mdDA neurons during development. It is crucial for expression of a set of genes such as SLC6A3, SLC18A2, TH and DRD2 which are essential for development of mdDA neurons [PMID: 17184956].
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Nurr1/NR4A2 antibody 66878-1-Ig | Download protocol |
| WB protocol for Nurr1/NR4A2 antibody 66878-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biochim Biophys Acta Mol Basis Dis OTUD7B inhibited hepatic injury from NAFLD by inhibiting K48-linked ubiquitination and degradation of β-catenin | ||
Front Mol Biosci Single-Cell Profiles of Age-Related Osteoarthritis Uncover Underlying Heterogeneity Associated With Disease Progression.
| ||
J Reprod Dev Parallel expression patterns of NR4A nuclear receptor family genes in the pituitary gland of proestrus rats | ||
World J Gastroenterol 3,6-dichlorobenzo[b]thiophene-2-carboxylic acid alleviates ulcerative colitis by suppressing mammalian target of rapamycin complex 1 activation and regulating intestinal microbiota | ||
J Pers Med Identification and Validation of Hub Genes in the Stenosis of Arteriovenous Fistula | ||
Mol Cell Neurosci BDNF-modified human umbilical cord mesenchymal stem cells-derived dopaminergic-like neurons improve rotation behavior of Parkinson's disease rats through neuroprotection and anti-neuroinflammation |






