Validation Data Gallery
Tested Applications
| Positive WB detected in | HepG2 cells, MCF-7 cells, MDA-MB-231 cells |
| Positive IP detected in | rat liver tissue |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 7 publications below |
| WB | See 71 publications below |
| IHC | See 16 publications below |
| IF | See 19 publications below |
| IP | See 2 publications below |
| CoIP | See 2 publications below |
Product Information
25055-1-AP targets NR1H4 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21878 Product name: Recombinant human NR1H4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-121 aa of BC130573 Sequence: MGSKMNLIEHSHLPTTDEFSFSENLFGVLTEQVAGPLGQNLEVEPYSQYSNVQFPQVQPQISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGETEVAEMPVTKKPRMGASAGRI 相同性解析による交差性が予測される生物種 |
| Full Name | nuclear receptor subfamily 1, group H, member 4 |
| Calculated molecular weight | 486 aa, 56 kDa |
| Observed molecular weight | 48-56 kDa |
| GenBank accession number | BC130573 |
| Gene Symbol | NR1H4 |
| Gene ID (NCBI) | 9971 |
| RRID | AB_2879874 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96RI1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Nuclear Receptor subfamily 1, group H, member 4 (NR1H4, also known as FXR) is a receptor for bile acids and has an important role in regulating energy metabolism in liver, muscle and adipose tissues in humans and animals. NR1H4 is highly expressed in liver and has a role in lipid metabolism, whereas none of the other protein-coding genes in the region has known biological links with cholesterol, further supporting a role for NR1H4 in regulation of cholesterol levels. NR1H4 have five isoforms, each isoform has a different expressional level and transcriptional activity depending on its location within specific tissues. (PMID: 14733360, PMID: 30787420)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for NR1H4 antibody 25055-1-AP | Download protocol |
| IP protocol for NR1H4 antibody 25055-1-AP | Download protocol |
| WB protocol for NR1H4 antibody 25055-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Host Microbe Dietary fiber alleviates alcoholic liver injury via Bacteroides acidifaciens and subsequent ammonia detoxification
| ||
Cell Host Microbe A gut microbiota-bile acid axis promotes intestinal homeostasis upon aspirin-mediated damage | ||
Sci Total Environ Bisphenol A induced hepatic steatosis by disturbing bile acid metabolism and FXR/TGR5 signaling pathways via remodeling the gut microbiota in CD-1 mice | ||
Phytomedicine Jiang-Tang-San-Huang pill alleviates type 2 diabetes mellitus through modulating the gut microbiota and bile acids metabolism | ||
Phytomedicine Wen-Shen-Jian-Pi-Hua-Tan decoction protects against early obesity-related glomerulopathy by improving renal bile acid composition and suppressing lipogenesis, inflammation, and fibrosis | ||
Biomater Sci Mesenchymal stem cell-derived exosome mitigates colitis via the modulation of the gut metagenomics-metabolomics-farnesoid X receptor axis |




