Validation Data Gallery
Tested Applications
| Positive WB detected in | HepG2 cells, HSC-T6 cells, L02 cells, K-562 cells |
| Positive IHC detected in | human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:2500-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 127 publications below |
| IHC | See 8 publications below |
| IF | See 3 publications below |
Product Information
67240-1-Ig targets NQO1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human, rat, pig |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28933 Product name: Recombinant human NQO1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-144 aa of BC007659 Sequence: MVGRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAV 相同性解析による交差性が予測される生物種 |
| Full Name | NAD(P)H dehydrogenase, quinone 1 |
| Calculated molecular weight | 274 aa, 31 kDa |
| Observed molecular weight | 29-31 kDa |
| GenBank accession number | BC007659 |
| Gene Symbol | NQO1 |
| Gene ID (NCBI) | 1728 |
| RRID | AB_2882519 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P15559 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
NQO1, also named as DIA4, NMOR1, DTD and QR1, belongs to the NAD(P)H dehydrogenase (quinone) family. This enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis. It is known to be involved in benzene metabolism. In human studies of ozone exposure, polymorphisms in oxidative stress genes (NQO1, GSTM1, GSTP1) modify respiratory symptoms, lung function, biomarkers and risk of asthma. (PMID:18511640; 18848868 )
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for NQO1 antibody 67240-1-Ig | Download protocol |
| IF protocol for NQO1 antibody 67240-1-Ig | Download protocol |
| IHC protocol for NQO1 antibody 67240-1-Ig | Download protocol |
| WB protocol for NQO1 antibody 67240-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Redox Biol Remote ischemic conditioning attenuates oxidative stress and inflammation via the Nrf2/HO-1 pathway in MCAO mice | ||
Free Radic Biol Med Honokiol protects against heavy-ion radiation-induced oxidative damage via the thioredoxin system | ||
Free Radic Biol Med Malic enzyme 1 reverses cardiomyocyte senescence in a nitric oxide-dependent manner | ||
Oxid Med Cell Longev Farrerol Enhances Nrf2-Mediated Defense Mechanisms against Hydrogen Peroxide-Induced Oxidative Damage in Human Retinal Pigment Epithelial Cells by Activating Akt and MAPK. | ||
Oxid Med Cell Longev Xuesaitong Combined with Dexmedetomidine Improves Cerebral Ischemia-Reperfusion Injury in Rats by Activating Keap1/Nrf2 Signaling and Mitophagy in Hippocampal Tissue |






