Validation Data Gallery
Tested Applications
| Positive WB detected in | HSC-T6 cells, C6 cells, HeLa cells, HepG2 cells, LNCaP cells, NIH/3T3 cells, RAW 264.7 cells, ROS1728 cells, MCF-7 cells, HEK-293 cells, Jurkat cells, K-562 cells |
| Positive IHC detected in | human breast cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 27 publications below |
| IHC | See 5 publications below |
| IF | See 23 publications below |
| IP | See 4 publications below |
| ChIP | See 1 publications below |
Product Information
60096-1-Ig targets B23/NPM1 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7415 Product name: Recombinant human B23 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-293 aa of BC002398 Sequence: MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKS 相同性解析による交差性が予測される生物種 |
| Full Name | nucleophosmin (nucleolar phosphoprotein B23, numatrin) |
| Calculated molecular weight | 33 kDa |
| Observed molecular weight | 35-38 kDa |
| GenBank accession number | BC002398 |
| Gene Symbol | NPM1 |
| Gene ID (NCBI) | 4869 |
| RRID | AB_2155162 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P06748 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Nucleophosmin (NPM1,B23) is a putative ribosome assembly factor with a high affinity for peptides containing nuclear localization signals (NLSs). The transport of proteins across the nuclear envelope is a selective, multistep process involving several cytoplasmic factors. Proteins must be recognized as import substrates, dock at the nuclear pore complex and translocate across the nuclear envelope in an ATP-dependent fashion. Several cytosolic and nuclear proteins that are central to this process have been identified. The 38 kDa nuclear protein nucleophosmin is involved in ribosomal assembly and rRNA transport. It is an abundant protein that is highly phosphorylated by Cdc2 kinase during mitosis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for B23/NPM1 antibody 60096-1-Ig | Download protocol |
| IHC protocol for B23/NPM1 antibody 60096-1-Ig | Download protocol |
| WB protocol for B23/NPM1 antibody 60096-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell lncRNAs maintain the functional phase state of nucleolar prion-like protein to facilitate rRNA processing | ||
Sci Adv Genomic gain of RRS1 promotes hepatocellular carcinoma through reducing the RPL11-MDM2-p53 signaling. | ||
Brain Interactome screening of C9orf72 dipeptide repeats reveals VCP sequestration and functional impairment by polyGA. | ||
Nat Commun A redox mechanism underlying nucleolar stress sensing by nucleophosmin.
| ||
Aging Cell Disruption of ER-mitochondria tethering and signalling in C9orf72-associated amyotrophic lateral sclerosis and frontotemporal dementia. |

















