Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse small intestine tissue, mouse colon tissue, rat colon tissue, rat small intestine tissue |
| Positive IP detected in | mouse colon tissue |
| Positive IHC detected in | human colon cancer Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 1 publications below |
| IHC | See 1 publications below |
Product Information
30973-1-AP targets NLRP6 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34516 Product name: Recombinant human NLRP6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-200 aa of NM_138329.2 Sequence: MDQPEAPCSSTGPRLAVARELLLAALEELSQEQLKRFRHKLRDVGPDGRSIPWGRLERADAVDLAEQLAQFYGPEPALEVARKTLKRADARDVAAQLQERRLQRLGLGSGTLLSVSEYKKKYREHVLQLHARVKERNARSVKITKRFTKLLIAPESAAPEEAMGPAEEPEPGRARRSDTHTFNRLFRRDEEGRRPLTVVL 相同性解析による交差性が予測される生物種 |
| Full Name | NLR family, pyrin domain containing 6 |
| Calculated molecular weight | 99 kDa |
| Observed molecular weight | 98-105 kDa |
| GenBank accession number | NM_138329.2 |
| Gene Symbol | NLRP6 |
| Gene ID (NCBI) | 171389 |
| RRID | AB_3669800 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P59044 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
NOD-like receptor family pyrin domain containing 6 (NLRP6) is also named as NACHT, LRR and PYD domains-containing protein 6 and ZFML, Angiotensin II/vasopressin receptor, NALP6 and PYPAF5. NLRP6 forms a complex with ASC and caspase-1 or caspase-11 to form an inflammasome complex cleaving pro-interleukin-1β (IL-1β) and IL-18 into their biologically active forms. The function of NLRP6 has been attributed to the maintenance of epithelial integrity and host defense against microbial infections (PMID: 33910012). NLRP6 is reported to involved in inflammasome activation, regulation of nuclear factor-κB (NF-κB) and mitogen-activated protein kinase (MAPK) signaling, antiviral interferon (IFN) signaling, mucus secretion, and antimicrobial peptide (AMP) production. NLRP6 is a novel NLR family member, that shows high expression in the intestine and liver (in contrast to NLRP3 in myeloid cells), to regulate inflammation and host defense against microbes (PMID: 32386845).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NLRP6 antibody 30973-1-AP | Download protocol |
| IHC protocol for NLRP6 antibody 30973-1-AP | Download protocol |
| IP protocol for NLRP6 antibody 30973-1-AP | Download protocol |
| WB protocol for NLRP6 antibody 30973-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Inflamm Res Integrated Single-Cell and Transcriptome Analysis with Experimental Validation Reveals PANoptosis-Related Gene Signatures in the Immune Microenvironment of Autoimmune Thyroiditis | ||
Cell Host Microbe UBE2O-mediated monoubiquitination licenses NLRP6 inflammasome activation in the intestine | ||
Nat Immunol Cytosolic CTH senses bacterial lipoproteins and drives noncanonical inflammasome activation.
|




