Validation Data Gallery
Tested Applications
| Positive WB detected in | Jurkat cells, THP-1 cells |
| Positive IP detected in | THP-1 cells |
| Positive IF/ICC detected in | HepG2 cells |
NLRP3 expression is relatively low in normal tissues(PMID: 33538177, 35676979, 25524927, 24166187)
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 106 publications below |
| IHC | See 23 publications below |
| IF | See 36 publications below |
| CoIP | See 1 publications below |
| ChIP | See 1 publications below |
Product Information
27458-1-AP targets NLRP3 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA, Immunohistochemistry applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig, rabbit |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26272 Product name: Recombinant human NLRP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 937-1036 aa of NM_001079821 Sequence: MLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW 相同性解析による交差性が予測される生物種 |
| Full Name | NLR family, pyrin domain containing 3 |
| Calculated molecular weight | 118 kDa |
| Observed molecular weight | 110 kDa |
| GenBank accession number | NM_001079821 |
| Gene Symbol | NLRP3 |
| Gene ID (NCBI) | 114548 |
| RRID | AB_2923578 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96P20 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
NLRP3, also named as NALP3, CIASI, C1orf7, PYPAF1, Cryopyrin and MIM606416, belongs to NLR family. NLRP3, a key and eponymous component of the NLRP3 inflammasome, plays a crucial role in innate immunity and inflammation. NLRP3 inflammasome is expressed in immune cells, including monocytes, macrophages, and dendritic cells. When the NLRP3 inflammasome is activated, the PYD domain of NLRP3 mediates recruitment of an adaptor protein called ASC and the effector protein procaspase-1 to form an NLRP3 inflammasome complex that can cleave inactive procaspase-1 to from active caspase-1. And then the active caspase-1 results in secretion of interleukin (IL)-18 and IL-1β. Activation of the NLRP3 inflammasome is also required for HMGB1 secretion. Inflammasomes can also induce pyroptosis, an inflammatory form of programmed cell death(PMID:27669650). NLRP3 has some isoforms with the MW of 106-118 kDa and 75-83 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NLRP3 antibody 27458-1-AP | Download protocol |
| IP protocol for NLRP3 antibody 27458-1-AP | Download protocol |
| WB protocol for NLRP3 antibody 27458-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Mater 2D Indium-Vacancy-Rich ZnIn2S4 Nanocatalysts for Sonocatalytic Cancer Suppression by Boosting Cancer-Cell Pyroptosis | ||
Cell Mol Immunol The BCL-2 inhibitor APG-2575 resets tumor-associated macrophages toward the M1 phenotype, promoting a favorable response to anti-PD-1 therapy via NLRP3 activation | ||
J Adv Res Tussilagone attenuated cigarette smoke-induced chronic obstructive pulmonary disease through regulating Nrf2 and NF-κB/NLRP3 inflammasome via directly targeting cysteine 434 of KEAP1. | ||
Redox Biol Anemoside B4 alleviates ulcerative colitis by attenuating intestinal oxidative stress and NLRP3 inflammasome via activating aryl hydrocarbon receptor through remodeling the gut microbiome and metabolites. | ||
Redox Biol Betaine alleviates cognitive impairment induced by homocysteine through attenuating NLRP3-mediated microglial pyroptosis in an m6A-YTHDF2-dependent manner | ||
J Nanobiotechnology Flos sophorae immaturus exosome-like nanovesicles alleviate ulcerative colitis by attenuating intestinal oxidative stress and inflammation through activating Aryl hydrocarbon receptor via gut microbiota and tryptophan metabolism regulation. |