Validation Data Gallery
Tested Applications
| Positive WB detected in | PC-12 cells, pig liver tissue, rat liver tissue, rat pancreas tissue, mouse liver tissue |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U-251 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IHC | See 1 publications below |
| IF | See 3 publications below |
| IP | See 1 publications below |
Product Information
67032-1-Ig targets NEU1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27945 Product name: Recombinant human NEU1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 96-415 aa of BC011900 Sequence: ARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL 相同性解析による交差性が予測される生物種 |
| Full Name | sialidase 1 (lysosomal sialidase) |
| Calculated molecular weight | 45 kDa |
| Observed molecular weight | 45-48 kDa |
| GenBank accession number | BC011900 |
| Gene Symbol | NEU1 |
| Gene ID (NCBI) | 4758 |
| RRID | AB_2882347 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q99519 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
NEU1 (lysosomal sialidase) encodes a kind of lysosomal enzyme that could cleave terminal sialic acids from glycoproteins or glycolipids to regulate various biological processes by conformational change (PMID:28130415). In the lysosome, NEU1 is one member of a heterotrimeric complex, the others are beta-galactosidase and cathepsin A. The NEU1 is widely expressed in mammalian tissues and involved in lysosomal storage disorder sialidosis, autoimmune diseases and the malignancy and metastasis of cancer cells (PMID:19075514). NUE1 also expresses on the plasma membrane where it modulates several signalling molecules about inflammation, exocytosis, phagocytosis, cell adhesion and proliferation (PMID:21928149). Additionally, it is reported that mutations in human NEU1 could lead to sialidosis (PMID:14517945).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NEU1 antibody 67032-1-Ig | Download protocol |
| IHC protocol for NEU1 antibody 67032-1-Ig | Download protocol |
| WB protocol for NEU1 antibody 67032-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Eur Rev Med Pharmacol Sci Long non-coding RNA TOB1-AS1 modulates cell proliferation, apoptosis, migration and invasion through miR-23a/NEU1 axis via Wnt/b-catenin pathway in gastric cancer. | ||
Research (Wash D C) Proteogenomic Characterization of High-Grade Lung Neuroendocrine Carcinoma Deciphers Molecular Diversity and Potential Biomarkers of Different Histological Subtypes in Chinese Population | ||
Br J Pharmacol Neuraminidase is a host-directed approach to regulate neutrophil responses in sepsis and COVID-19 | ||
Biomed Pharmacother Oseltamivir enhances 5-FU sensitivity in esophageal squamous carcinoma with high SPNS1 | ||
Front Pharmacol New use of an old drug: mechanism of oseltamivir phosphate inhibiting liver cancer through regulation of lipophagy via NEU1 |





