Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, human placenta tissue, mouse spleen tissue, HepG2 cells, mouse testis tissue, rat spleen tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human lymphoma tissue, human placenta tissue, human rectal cancer tissue, human tonsillitis tissue, mouse skin tissue, rat adrenal gland tissue, rat bladder tissue, rat skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:9000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 4 publications below |
| IHC | See 2 publications below |
| IF | See 2 publications below |
| IP | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
11192-1-AP targets NEK9 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1678 Product name: Recombinant human NEK9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 734-979 aa of BC009336 Sequence: RSNSSGLSIGTVFQSSSPGGGGGGGGGEEEDSQQESETPDPSGGFRGTMEADRGMEGLISPTEAMGNSNGASSSCPGWLRKELENAEFIPMPDSPSPLSAAFSESEKDTLPYEELQGLKVASEAPLEHKPQVEASSPRLNPAVTCAGKGTPLTPPACACSSLQVEVERLQGLVLKCLAEQQKLQQENLQIFTQLQKLNKKLEGGQQVGMHSKGTQTAKEEMEMDPKPDLDSDSWCLLGTDSCRPSL 相同性解析による交差性が予測される生物種 |
| Full Name | NIMA (never in mitosis gene a)- related kinase 9 |
| Calculated molecular weight | 107 kDa |
| Observed molecular weight | 120 kDa |
| GenBank accession number | BC009336 |
| Gene Symbol | NEK9 |
| Gene ID (NCBI) | 91754 |
| RRID | AB_2150800 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TD19 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
NEK9 is also named as KIAA1995, NEK8, NERCC and belongs to the NEK Ser/Thr protein kinase family. It is originally identified as αβ-casein kinase that associates with a putative substrate Bicd2. It is also independently identified as a Nek6- and Ran GTPase-binding protein under a different name, Nercc1(PMID:14660563). Nek9, together with the highly similar (80% identical) Nek6 and Nek7, form a signaling module that is activated during mitosis and involved in the regulation of the mitotic spindle. The endogenous Nek9 (with predicted molecular mass of 120 kDa) has an apparent molecular mass of 600 kDa, also compatible with a tetramer(PMID:21454704).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for NEK9 antibody 11192-1-AP | Download protocol |
| IF protocol for NEK9 antibody 11192-1-AP | Download protocol |
| IHC protocol for NEK9 antibody 11192-1-AP | Download protocol |
| IP protocol for NEK9 antibody 11192-1-AP | Download protocol |
| WB protocol for NEK9 antibody 11192-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
JBMR Plus Identification of Chloride Intracellular Channel Protein 3 as a Novel Gene Affecting Human Bone Formation. | ||
Cancers (Basel) Differential Expression of NEK Kinase Family Members in Esophageal Adenocarcinoma and Barrett's Esophagus | ||
Biofactors FAM49B drives colorectal cancer progression by stabilizing c-Myc through NEK9 phosphorylation | ||
Cell Death Differ USP19 potentiates autophagic cell death via inhibiting mTOR pathway through deubiquitinating NEK9 in pancreatic cancer | ||
Gut Targeting NEK9 synergises with immunotherapy in hepatocellular carcinoma by remodelling the immunosuppressive microenvironment
|

















