Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293T cells, HepG2 cells, mouse brain tissue, mouse heart tissue, rat heart tissue, rat brain tissue, NIH/3T3 cells |
| Positive IP detected in | mouse heart tissue |
| Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 31 publications below |
| IHC | See 6 publications below |
| IF | See 2 publications below |
Product Information
15066-1-AP targets NDUFS3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7072 Product name: Recombinant human NDUFS3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-264 aa of BC000617 Sequence: MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK 相同性解析による交差性が予測される生物種 |
| Full Name | NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Q reductase) |
| Calculated molecular weight | 30 kDa |
| Observed molecular weight | 30 kDa |
| GenBank accession number | BC000617 |
| Gene Symbol | NDUFS3 |
| Gene ID (NCBI) | 4722 |
| RRID | AB_2151109 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75489 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
NDUFS3(NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial) is also named as CI-30kD and belongs to the complex I 30 kDa subunit family. It catalyzes the oxidation of NADH, with the concomitant reduction of ubiquinone and ejection of protons out of the mitochondria(PMID:10967146). NDUFS3 can be used as a mitochondrial matrix control(PMID:17344420). The full length has a transit peptide with 36 amino acids.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NDUFS3 antibody 15066-1-AP | Download protocol |
| IHC protocol for NDUFS3 antibody 15066-1-AP | Download protocol |
| IP protocol for NDUFS3 antibody 15066-1-AP | Download protocol |
| WB protocol for NDUFS3 antibody 15066-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Discov NCOA4-Mediated Ferritinophagy Is a Pancreatic Cancer Dependency via Maintenance of Iron Bioavailability for Iron-Sulfur Cluster Proteins | ||
Mol Cell Maintaining Iron Homeostasis Is the Key Role of Lysosomal Acidity for Cell Proliferation. | ||
J Cell Biol PDGFRβ translocates to the nucleus and regulates chromatin remodeling via TATA element-modifying factor 1. | ||
Diabetes DW14006 as a Direct AMPKα Activator Ameliorates Diabetic Peripheral Neuropathy in Mice. | ||
J Med Genet COA7 (C1orf163/RESA1) mutations associated with mitochondrial leukoencephalopathy and cytochrome c oxidase deficiency. |




