Validation Data Gallery
Tested Applications
| Positive WB detected in | LNCaP cells, human heart tissue, human skeletal muscle tissue, MCF-7 cells, mouse skeletal muscle tissue, Neuro-2a cells, rat heart tissue, HeLa cells, HepG2 cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, Jurkat cells, PC-3 cells, HT-29 cells, HCT 116 cells, MOLT-4 cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 12 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
Product Information
66385-1-Ig targets NAMPT/PBEF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2434 Product name: Recombinant human NAMPT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC020691 Sequence: MNPAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRV 相同性解析による交差性が予測される生物種 |
| Full Name | nicotinamide phosphoribosyltransferase |
| Calculated molecular weight | 52 kDa |
| Observed molecular weight | 52 kDa |
| GenBank accession number | BC020691 |
| Gene Symbol | NAMPT/PBEF |
| Gene ID (NCBI) | 10135 |
| RRID | AB_2881761 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P43490 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Nicotinamide phosphoribosyltransferase(NAMPT) has two usual synonyms termed Visfatin and PBEF. Its primary role is to catalyze the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, an intermediate in the biosynthesis of NAD, which is the rate limiting component in the mammalian NAD biosynthesis pathway. NAMPT is localized in cytoplasm and expressed in large amounts in bone marrow, liver tissue, and muscle tissues. NAMPT inhibits neutrophil apoptosis in experimental inflammation and clinical sepsis. NAMPT levels are altered in plasma of patients with type 2 diabetes mellitus (T2DM), and it is now evidenced that NAMPT may plays a role in lipid metabolism.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NAMPT/PBEF antibody 66385-1-Ig | Download protocol |
| IHC protocol for NAMPT/PBEF antibody 66385-1-Ig | Download protocol |
| WB protocol for NAMPT/PBEF antibody 66385-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab Nicotinamide metabolism face-off between macrophages and fibroblasts manipulates the microenvironment in gastric cancer | ||
Cell Chem Biol NAMPT-targeting PROTAC and nicotinic acid co-administration elicit safe and robust anti-tumor efficacy in NAPRT-deficient pan-cancers | ||
Adv Biol (Weinh) NAMPT/NAD+ /PARP1 Pathway Regulates CFA-Induced Inflammatory Pain via NF-κB Signaling in Rodents | ||
J Cell Physiol Nicotinamide phosphoribosyl transferase regulates cell growth via the Sirt1/P53 signaling pathway and is a prognosis marker in colorectal cancer.
| ||
Cell Rep NAD+ supplement potentiates tumor-killing function by rescuing defective TUB-mediated NAMPT transcription in tumor-infiltrated T cells. | ||
Adv Sci (Weinh) Nicotine Reprograms Aging-Related Metabolism and Protects Against Motor Decline in Mice |











