Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse spleen tissue, mouse lung tissue |
| Positive IHC detected in | mouse spleen tissue, mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | LPS and Brefeldin A treated RAW 264.7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 7 publications below |
| IHC | See 2 publications below |
Product Information
82854-8-RR targets Mmp9 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg0452 Product name: Recombinant Mouse MMP-9 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-730 aa of NM_013599 Sequence: APYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTAGSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRLGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDHEVNQVDDVGYVTYDLLQCP 相同性解析による交差性が予測される生物種 |
| Full Name | matrix metallopeptidase 9 |
| Calculated molecular weight | 81kd |
| Observed molecular weight | 92-100 kDa |
| GenBank accession number | NM_013599 |
| Gene Symbol | Mmp9 |
| Gene ID (NCBI) | 17395 |
| RRID | AB_3670580 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P41245-1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Mmp9 (matrix metallopeptidase 9), also known as Clg4b. It is expected to be located inextracellular matrix. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, tissue remodeling, and disease processes, such as arthritis or metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. Studies in rhesus monkeys suggest that MMP9 is involved in IL-8-induced mobilization hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. The pro-MMP9 is 92 kDa, and it can be detected a processed form of 68 kDa. This protein can exist as a dimer of 180 kDa (PMID:7492685).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Mmp9 antibody 82854-8-RR | Download protocol |
| IHC protocol for Mmp9 antibody 82854-8-RR | Download protocol |
| WB protocol for Mmp9 antibody 82854-8-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Biol Rep A SASP-related four-gene signature associated with intervertebral disc degeneration: integrated bioinformatics analysis and validation of pinocembrin as a therapeutic candidate. | ||
Sci Rep Anti-glioma mechanism of Angelica sinensis and stigmasterol: p53-associated ferroptosis identified via multi-method analysis. | ||
Cell Signal KLF2 interacts with AP-1 to negatively affect osteoclast differentiation and activity. | ||
J Orthop Translat Txnip regulates glycolysis and tricarboxylic acid cycle balance to maintain bone homeostasis.
| ||
Int Immunopharmacol Bee sting acupuncture mitigates osteoarthritis in male mice via PPAR-γ activation: integrated network pharmacology, transcriptomics, and experimental validation. | ||
Animal Model Exp Med Long noncoding RNA GCH1 mediates mitophagy via the PTEN-induced kinase 1/Parkin pathway to drive chondrocyte dysfunction and cartilage degeneration in osteoarthritis |






