Validation Data Gallery
Tested Applications
| Positive IHC detected in | human colon tissue, human pancreas cancer tissue, mouse small intestine tissue, rat small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human colon tissue, mouse colon tissue, rat small intestine tissue |
| Positive IF/ICC detected in | HepG2 cells, SW480 cells |
| Positive FC (Intra) detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.13 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 26 publications below |
| IHC | See 48 publications below |
| IF | See 64 publications below |
Product Information
27675-1-AP targets MUC2 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, chicken, mosquito, duck |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25800 Product name: Recombinant human MUC2 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 726-850 aa of M94132 Sequence: MYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWV 相同性解析による交差性が予測される生物種 |
| Full Name | mucin 2, oligomeric mucus/gel-forming |
| Calculated molecular weight | 540 kDa |
| GenBank accession number | M94132 |
| Gene Symbol | MUC2 |
| Gene ID (NCBI) | 4583 |
| RRID | AB_2880943 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q02817 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. Downregulation of this gene has been observed in patients with Crohn disease and ulcerative colitis.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for MUC2 antibody 27675-1-AP | Download protocol |
| IF protocol for MUC2 antibody 27675-1-AP | Download protocol |
| IHC protocol for MUC2 antibody 27675-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Dubosiella newyorkensis modulates immune tolerance in colitis via the L-lysine-activated AhR-IDO1-Kyn pathway | ||
Acta Pharm Sin B PIM1-HDAC2 axis modulates intestinal homeostasis through epigenetic modification | ||
EMBO J Myeloid cells protect intestinal epithelial barrier integrity through the angiogenin/plexin-B2 axis. | ||
Carbohydr Polym Polygonatum cyrtonema Hua polysaccharide alleviates ulcerative colitis via gut microbiota-independent modulation of inflammatory immune response | ||
Pharmacol Res λ-carrageenan exacerbates Citrobacter rodentium-induced infectious colitis in mice by targeting gut microbiota and intestinal barrier integrity | ||
NPJ Biofilms Microbiomes Impact of structurally diverse polysaccharides on colonic mucin O-glycosylation and gut microbiota |














