Validation Data Gallery
Tested Applications
| Positive WB detected in | SW480 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells |
| Positive IHC detected in | mouse brain tissue, human lung tissue, mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:2000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.2 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 6 publications below |
| IF | See 2 publications below |
| IP | See 1 publications below |
Product Information
66195-1-Ig targets MTA2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11713 Product name: Recombinant human MTA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC053650 Sequence: MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLVEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISV 相同性解析による交差性が予測される生物種 |
| Full Name | metastasis associated 1 family, member 2 |
| Calculated molecular weight | 668 aa, 75 kDa |
| Observed molecular weight | 75 kDa |
| GenBank accession number | BC053650 |
| Gene Symbol | MTA2 |
| Gene ID (NCBI) | 9219 |
| RRID | AB_2877118 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O94776 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Metastasis-associated protein MTA2, also named as MTA1L1 or PID, is a 668 amino acid protein, which contains one BAH domain, one ELM2 domain, one GATA-type zinc finger and one SANT domain. MTA2 localizes in the nucleus and is widely expressed in many tissues. MTA2 may be involved in the regulation of gene expression as repressor and activator.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for MTA2 antibody 66195-1-Ig | Download protocol |
| IF protocol for MTA2 antibody 66195-1-Ig | Download protocol |
| IHC protocol for MTA2 antibody 66195-1-Ig | Download protocol |
| WB protocol for MTA2 antibody 66195-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Dev Cell Nucleoporin Seh1 controls murine neocortical development via transcriptional repression of p21 in neural stem cells | ||
Theranostics LncRNA-MTA2TR functions as a promoter in pancreatic cancer via driving deacetylation-dependent accumulation of HIF-1α.
| ||
Cell Mol Gastroenterol Hepatol Targeting HNRNPM Inhibits Cancer Stemness and Enhances Antitumor Immunity in Wnt-activated Hepatocellular Carcinoma. | ||
Oncol Lett Demethylation of HACE1 gene promoter by propofol promotes autophagy of human A549 cells. | ||
Mol Cancer Loss of TACC2 impairs chemokine CCL3 and CCL4 expression and reduces response to anti-PD-1 therapy in soft tissue sarcoma | ||
Cancers (Basel) ZEB2/TWIST1/PRMT5/NuRD Multicomplex Contributes to the Epigenetic Regulation of EMT and Metastasis in Colorectal Carcinoma |






