Recombinant human MRAS protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag5433
Synonyms
FLJ42964; M-RAs; R-RAS3; RRAS3
Validation Data Gallery
Product Information
| Peptide Sequence |
MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAG
(1-70 aa encoded by BC047690) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
