Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, fetal human brain tissue, HEK-293 cells, HepG2 cells, human brain tissue, human kidney tissue, NIH/3T3 cells, rat brain tissue, RAW 264.7 cells |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse testis tissue, human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | Hela cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 5 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
66049-1-Ig targets MMS19 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8960 Product name: Recombinant human MMS19 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 457-803 aa of BC006575 Sequence: FLDGNVSFLPENSFPSRFQPFQDGSSGQRRLIALLMAFVCSLPRNVEIPQLNQLMRELLELSCCHSCPFSSTAAAKCFAGLLNKHPAGQQLDEFLQLAVDKVEAGLDSGPCRSQAFTLLLWVTKALVLRYHPLSSCLTARLMGLLSDPELGPAAADGFSLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVQGFHAAPQDVKPNYLKGLSHVLNRLPKPVLLPELPTLLSLLLEALSCPDCVVQLSTLSCLQPLLLEAPQVMSLHVDTLVTKFLNLSSSPSMAVRIAALQCMHALTRLPTPVLLPYKPQVIRALAKPLDDKKRLVRKEAVSARGEWFLLGSPGS 相同性解析による交差性が予測される生物種 |
| Full Name | MMS19 nucleotide excision repair homolog (S. cerevisiae) |
| Calculated molecular weight | 1030 aa, 113 kDa |
| Observed molecular weight | 103 kDa, 38 kDa |
| GenBank accession number | BC006575 |
| Gene Symbol | MMS19 |
| Gene ID (NCBI) | 64210 |
| RRID | AB_11041708 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q96T76 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
MMS19 (MMS19 nucleotide excision repair homolog), also known as MET18, is a 1,030 amino acid nuclear protein containing seven HEAT repeats that belongs to the MET18/MMS19 family. Via its interactions with TFIIH p80 and TFIIH p89 helicases, MMS19 plays a role in nucleotide excision repair (NER) and RNA polymerase II (Pol II) transcription. MMS19 may also function as a transcriptional coactivator of estrogen receptor. While ubiquitously expressed, highest levels of MMS19 have been found in testis. At least five distinct MMS19 protein isoforms exist, which are produced by alternative splicing events.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MMS19 antibody 66049-1-Ig | Download protocol |
| IHC protocol for MMS19 antibody 66049-1-Ig | Download protocol |
| IP protocol for MMS19 antibody 66049-1-Ig | Download protocol |
| WB protocol for MMS19 antibody 66049-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Science MMS19 assembles iron-sulfur proteins required for DNA metabolism and genomic integrity.
| ||
Mol Cell An Oxygen-Dependent Interaction between FBXL5 and the CIA-Targeting Complex Regulates Iron Homeostasis. | ||
J Biol Chem Iron-Regulated Assembly of the Cytosolic Iron-Sulfur Cluster Biogenesis Machinery. | ||
Cancer Biomark MMS19 as a potential predictive marker of adjuvant chemotherapy benefit in resected non-small cell lung cancer.
| ||
Aging (Albany NY) Exploring Cancer Dependency Map genes and immune subtypes in colon cancer, in which TIGD1 contributes to colon cancer progression |















