Validation Data Gallery
Tested Applications
| Positive WB detected in | human saliva tissue |
| Positive IP detected in | human saliva tissue |
| Positive IHC detected in | human tonsillitis tissue, human lung cancer tissue, human spleen tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 65 publications below |
| IHC | See 10 publications below |
| IF | See 3 publications below |
| CoIP | See 1 publications below |
Product Information
27306-1-AP targets MMP-9 (Middle) in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26132 Product name: Recombinant human MMP9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 210-346 aa of BC006093 Sequence: WSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGEL 相同性解析による交差性が予測される生物種 |
| Full Name | matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase) |
| Calculated molecular weight | 707 aa, 78 kDa |
| Observed molecular weight | 92 kDa |
| GenBank accession number | BC006093 |
| Gene Symbol | MMP-9 |
| Gene ID (NCBI) | 4318 |
| RRID | AB_2880837 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P14780 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, tissue remodeling, and disease processes, such as arthritis or metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. Matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase) (MMP9, synonyms: GELB, CLG4B) degrades collagens type IV and V. Studies in rhesus monkeys suggest that MMP9 is involved in IL-8-induced mobilization hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. The pro-MMP9 is 92 kDa, and it can be detected a processed form of 68 kDa or 82 kDa. This protein can exist as a dimer of 180 kDa (PMID:7492685).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MMP-9 (Middle) antibody 27306-1-AP | Download protocol |
| IP protocol for MMP-9 (Middle) antibody 27306-1-AP | Download protocol |
| WB protocol for MMP-9 (Middle) antibody 27306-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Photothermal-Responsive Soluble Microneedle Patches for Meibomian Gland Dysfunction Therapy | ||
Bioeng Transl Med Macrophages overexpressing interleukin-10 target and prevent atherosclerosis: Regression of plaque formation and reduction in necrotic core | ||
Int J Mol Sci Comprehensive Analysis of MICALL2 Reveals Its Potential Roles in EGFR Stabilization and Ovarian Cancer Cell Invasion | ||
Front Endocrinol (Lausanne) Nicotinamide mononucleotide attenuates HIF-1α activation and fibrosis in hypoxic adipose tissue via NAD+/SIRT1 axis | ||
Int J Biol Sci TDG suppresses the migration and invasion of human colon cancer cells via the DNMT3A/TIMP2 axis. | ||
Front Mol Biosci Comprehensive Characterization of Ageing-Relevant Subtypes Associated With Different Tumorigenesis and Tumor Microenvironment in Prostate Cancer. |










