Validation Data Gallery
Tested Applications
| Positive WB detected in | HT-1080 cells, MCF-7 cells, U-87 MG cells, HepG2 cells, U-251 cells, J774A.1 cells |
| Positive IP detected in | MCF-7 cells |
| Positive IHC detected in | human gliomas tissue, human placenta tissue, human prostate cancer tissue, human heart tissue, human oesophagus tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human placenta tissue |
| Positive IF/ICC detected in | HepG2 cells |
In sample preparation, the extracellular matrix needs to be included
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 1039 publications below |
| IHC | See 162 publications below |
| IF | See 65 publications below |
| IP | See 1 publications below |
Product Information
10373-2-AP targets MMP2 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, rabbit, monkey, chicken, goat, fish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0549 Product name: Recombinant human MMP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 461-660 aa of BC002576 Sequence: LGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC 相同性解析による交差性が予測される生物種 |
| Full Name | matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) |
| Calculated molecular weight | 72 kDa |
| Observed molecular weight | 62-72 kDa |
| GenBank accession number | BC002576 |
| Gene Symbol | MMP2 |
| Gene ID (NCBI) | 4313 |
| RRID | AB_2250823 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P08253 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
MMP2, also named as CLG4A, Gelatinase Am, TBE-1 and PEX, belongs to the peptidase M10A family. It is ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. MMP2 contributes to myocardial oxidative stress by regulating the activity of GSK3beta. It cleaves GSK3beta in vitro. MMP2 can be cleaved into PEX chain(~60kd). Western blot analysis showed that the 72 kDa and 62/65 kDa proteinase activities were pro-MMP2 and the active enzyme, respectively (PMID:11112697,PMID: 30867536).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MMP2 antibody 10373-2-AP | Download protocol |
| IHC protocol for MMP2 antibody 10373-2-AP | Download protocol |
| IP protocol for MMP2 antibody 10373-2-AP | Download protocol |
| WB protocol for MMP2 antibody 10373-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Hematol Oncol Ilamycin C induces apoptosis and inhibits migration and invasion in triple-negative breast cancer by suppressing IL-6/STAT3 pathway. | ||
Mol Cancer Down-regulation of miR-675-5p contributes to tumor progression and development by targeting pro-tumorigenic GPR55 in non-small cell lung cancer. | ||
Mol Cancer Alteration of tumor suppressor BMP5 in sporadic colorectal cancer: a genomic and transcriptomic profiling based study. | ||
Mol Cancer MicroRNA-505 functions as a tumor suppressor in endometrial cancer by targeting TGF-α. | ||
Mol Cancer Long non-coding RNA PVT1 promotes tumor progression by regulating the miR-143/HK2 axis in gallbladder cancer. | ||
Mol Cancer Role of the lncRNA ABHD11-AS1 in the tumorigenesis and progression of epithelial ovarian cancer through targeted regulation of RhoC. |