Validation Data Gallery
Tested Applications
| Positive WB detected in | MCF7 cells, mouse placenta tissue, MCF-7 cells, A549 cells, Jurkat cells, mouse brain tissue, rat brain tissue |
| Positive IP detected in | MCF-7 cells |
| Positive IHC detected in | human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 3 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
20292-1-AP targets MLN64 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14061 Product name: Recombinant human MLN64,STARD3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 170-445 aa of BC008747 Sequence: DFKVLPQEAEEERWYLAAQVAVARGPLLFSGALSEGQFYSPPESFAGSDNESDEEVAGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNKTVTACQILQRVEDNTLISYDVSAGAAGGVVSPRDFVNVRRIERRRDRYLSSGIATSHSAKPPTHKYVRGENGPGGFIVLKSASNPRVCTFVWILNTDLKGRLPRYLIHQSLAATMFEFAFHLRQRISELGARA 相同性解析による交差性が予測される生物種 |
| Full Name | StAR-related lipid transfer (START) domain containing 3 |
| Calculated molecular weight | 445 aa, 51 kDa |
| Observed molecular weight | 33-53 kDa |
| GenBank accession number | BC008747 |
| Gene Symbol | MLN64/STARD3 |
| Gene ID (NCBI) | 10948 |
| RRID | AB_10643978 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14849 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
MLN64 (also known as STARD3) is an integral membrane protein anchored in late endosomes. MLN64 has a StAR-related lipid-transfer (START) domain to bind cholesterol, mediating intracellular cholesterol transfer. MLN64 is widely expressed in multiple tissues including liver, spleen, heart, kidney, lung, and the brain. Higher expression of MLN64 has been found in several malignancies. MLN64 can be detected as 33 kDa truncated fragment (PMID:9237999, PMID:15718238).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MLN64 antibody 20292-1-AP | Download protocol |
| IHC protocol for MLN64 antibody 20292-1-AP | Download protocol |
| IP protocol for MLN64 antibody 20292-1-AP | Download protocol |
| WB protocol for MLN64 antibody 20292-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Life Sci Blockade of STARD3-mediated cholesterol transport alleviates diabetes-induced podocyte injury by reducing mitochondrial cholesterol accumulation
| ||
J Cell Sci The lysosomal lipid transporter LIMP-2 is part of lysosome-ER STARD3-VAPB-dependent contact sites | ||
J Am Heart Assoc Inhibition of NPC Intracellular Cholesterol Transporter 1 Dually Regulates Aldosterone Secretion Via the Steroidogenic Acute Regulatory-Related Lipid Transfer Domain-3-Voltage-Dependent Anion Channel 1 Axis and Inositol 1,4,5-Trisphosphate Receptor Type 3-Calcium Signaling. | ||
Int J Womens Health Novel Perspective for Prognostic Stratification and Personalized Therapy in Breast Cancer Patients: Development of Cancer Stem Cells and Metabolism-Associated Prognostic Model. |














