Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells |
| Positive IHC detected in | human small intestine tissue, human tonsillitis tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 30 publications below |
| IHC | See 3 publications below |
| IF | See 19 publications below |
| ChIP | See 5 publications below |
Product Information
21166-1-AP targets MKL1/MRTF-A in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15240 Product name: Recombinant human MKL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 392-741 aa of BC115039 Sequence: KAPAATSILHKAGEVVVAFPAARLSTGPALVAAGLAPAEVVVATVASSGVVKFGSTGSTPPVSPTPSERSLLSTGDENSTPGDTFGEMVTSPLTQLTLQASPLQILVKEEGPRAGSCCLSPGGRAELEGRDKDQMLQEKDKQIEALTRMLRQKQQLVERLKLQLEQEKRAQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPSLAAPATNHIDPCAVAPGPPSVVVKQEALQPEPEPVPAPQLLLGPQGPGLIKGVAPPTLITDSTGTHLVLTVTNKNADSPGLSSGSPQQPSSQPGSPAPAPSAQMDLEHPLQPLFGTPTSLLKKEPPGYEEAMSQQPKQQEN 相同性解析による交差性が予測される生物種 |
| Full Name | megakaryoblastic leukemia (translocation) 1 |
| Calculated molecular weight | 931 aa, 99 kDa |
| Observed molecular weight | 145 kDa |
| GenBank accession number | BC115039 |
| Gene Symbol | MKL1 |
| Gene ID (NCBI) | 57591 |
| RRID | AB_2878822 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q969V6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Megakaryocytic leukemia 1 (MKL1), also known as myocardin-related transcription factor A (MRTF-A), is a transcriptional regulator involved in a wide range of pathophysiological processes in the cardiovascular system. MKL1 was initially identified as a co-factor for serum response factor (SRF) to regulate the transcription of contractile genes. Forced expression of MKL1 in non-muscle cells leads to robust up-regulation of contractile genes (PMID: 36587486, PMID: 37199168, PMID: 39222836). MKL1 is ubiquitously expressed and has been detected in lung, placenta, small intestine, liver, kidney, spleen, thymus, colon, muscle, heart, and brain. The molecular weight of MKL1 observed is consistent with what has been described in the literature (PMID: 34944031).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MKL1/MRTF-A antibody 21166-1-AP | Download protocol |
| IHC protocol for MKL1/MRTF-A antibody 21166-1-AP | Download protocol |
| WB protocol for MKL1/MRTF-A antibody 21166-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Stem Cell An injury-responsive Rac-to-Rho GTPase switch drives activation of muscle stem cells through rapid cytoskeletal remodeling. | ||
Nat Cell Biol Myc-dependent dedifferentiation of Gata6+ epidermal cells resembles reversal of terminal differentiation | ||
J Cell Biol The actin-MRTF-SRF transcriptional circuit controls tubulin acetylation via α-TAT1 gene expression. | ||
Elife Differential regulation of cranial and cardiac neural crest by serum response factor and its cofactors. | ||
Exp Mol Med MRTF-A-NF-κB/p65 axis-mediated PDL1 transcription and expression contributes to immune evasion of non-small-cell lung cancer via TGF-β
| ||
Oncotarget The Wnt-β-catenin signaling regulated MRTF-A transcription to activate migration-related genes in human breast cancer cells. |







