Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293T cells, HepG2 cells, U-937 cells, mouse testis tissue, Jurkat cells |
| Positive IHC detected in | rat liver tissue, human lung tissue, mouse lung tissue, mouse spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat liver tissue |
| Positive FC (Intra) detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 13 publications below |
| IHC | See 2 publications below |
| IF | See 4 publications below |
| ELISA | See 1 publications below |
Product Information
27900-1-AP targets MERTK in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27540 Product name: Recombinant human MERTK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 829-999 aa of BC114918 Sequence: ELYEIMYSCWRTDPLDRPTFSVLRLQLEKLLESLPDVRNQADVIYVNTQLLESSEGLAQGSTLAPLDLNIDPDSIIASCTPRAAISVVTAEVHDSKPHEGRYILNGGSEEWEDLTSAPSAAVTAEKNSVLPGERLVRNGVSWSHSSMLPLGSSLPDELLFADDSSEGSEVLM 相同性解析による交差性が予測される生物種 |
| Full Name | c-mer proto-oncogene tyrosine kinase |
| Calculated molecular weight | 999 aa, 110 kDa |
| Observed molecular weight | 150-180 kDa |
| GenBank accession number | BC114918 |
| Gene Symbol | MERTK |
| Gene ID (NCBI) | 10461 |
| RRID | AB_3086006 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q12866 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
MerTK (Mer tyrosine kinase), also known as RP38, c-Eyk, c-mer, and Tyro12, was first cloned from a human B lymphoblastoid expression library (PMID:8086340) and is one of the TAM (Tyro-3, Axl, and MerTK) receptor tyrosine kinase (RTK) family (PMID:23833304). Although this RTK, like others, can promote tumor cell proliferation to some extent, MERTK primarily lends tumor cells crucial survival advantages while promoting invasion, migration and metastasis, drug resistance, and, in the innate immune system, suppressing anti-tumor immunity (PMID:32417270). The multiple MERTK species observed are likely due to posttranslational modifications (PMID: 23585477).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for MERTK antibody 27900-1-AP | Download protocol |
| IF protocol for MERTK antibody 27900-1-AP | Download protocol |
| IHC protocol for MERTK antibody 27900-1-AP | Download protocol |
| WB protocol for MERTK antibody 27900-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Rep Med Disruption of MerTK increases the efficacy of checkpoint inhibitor by enhancing ferroptosis and immune response in hepatocellular carcinoma | ||
Mater Today Bio Cholesterol analogs modulate lipid nanoparticle performance for mRNA delivery after lyophilization and enable ocular disease therapy. | ||
Phytomedicine Baoganning decoction mitigates liver fibrosis via regulating IDO1-mediated macrophage efferocytosis. | ||
Int J Biol Macromol Omentin-1 promotes diabetic wound healing by regulating macrophage efferocytosis and M2 polarization. | ||
Phytomedicine Daphnetin alleviates influenza pneumonia by enhancing chaperone-mediated autophagy of KEAP1 through Heat shock cognate 71 kDa protein. | ||
Brain Behav Immun LXR-β regulates microglial efferocytosis and neuroinflammation in CPSP via STAT6 activation |








