Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, NIH/3T3 cells, 4T1 cells, HSC-T6 cells |
| Positive IHC detected in | human breast cancer tissue, human colon cancer tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IF | See 1 publications below |
Product Information
80906-1-RR targets Lamin B1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag3631 Product name: Recombinant human Lamin B1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 237-587 aa of BC012295 Sequence: EYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLQGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM 相同性解析による交差性が予測される生物種 |
| Full Name | lamin B1 |
| Calculated molecular weight | 66 kDa |
| Observed molecular weight | 66-70 kDa |
| GenBank accession number | BC012295 |
| Gene Symbol | Lamin B1 |
| Gene ID (NCBI) | 4001 |
| ENSEMBL Gene ID | ENSG00000113368 |
| RRID | AB_2918918 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P20700 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Lamins are components of the nuclear lamina, a fibrous layer on the nucleoplasmic side of the inner nuclear membrane, which is thought to provide a framework for the nuclear envelope and may also interact with chromatin. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B1. Expression of uncleavable mutant lamin A or B caused significant delays in the onset of chromatin condensation and nuclear shrinkage during apoptosis (PMID:11953316). This protein is not suitable for samples where the nuclear envelope has been removed.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Lamin B1 antibody 80906-1-RR | Download protocol |
| IHC protocol for Lamin B1 antibody 80906-1-RR | Download protocol |
| WB protocol for Lamin B1 antibody 80906-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Contact (Thousand Oaks) mtDNA-Depleted Mitochondria Form Sites of Contact with the Nucleus and Alter the Cellular Epigenome. | ||
J Agric Food Chem Apigenin Alleviates Fumonisin B1-Induced Hepatotoxicity by Suppressing Ferroptosis through the Nrf2/FSP1 Pathway. | ||
Behav Brain Funct Isoacteoside alleviates LPS-induced depressive-like behaviors in mice by inhibiting neuroinflammation through regulating microglial polarization and oxidative stress. | ||
ACS Nano Targeted Degradation of Signal Transduction and Activator of Transcription 3 by Chaperone-Mediated Autophagy Targeting Chimeric Nanoplatform | ||
Cell Death Discov Novel mechanism of neuronal hypoxia response: HIF-1α/STOML2 mediated PINK1-dependent mitophagy activation against neuronal injury. |








