Validation Data Gallery
Tested Applications
| Positive WB detected in | K-562 cells, NCCIT cells, mouse embryo tissue | 
| Positive IP detected in | K-562 cells | 
| Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
| Positive IF/ICC detected in | human embronic stem cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below | 
| WB | See 29 publications below | 
| IHC | See 18 publications below | 
| IF | See 14 publications below | 
| IP | See 2 publications below | 
| RIP | See 1 publications below | 
Product Information
11724-1-AP targets LIN28A in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat, canine | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag2312 Product name: Recombinant human LIN28 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-209 aa of BC028566 Sequence: MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN相同性解析による交差性が予測される生物種 | 
| Full Name | lin-28 homolog (C. elegans) | 
| Calculated molecular weight | 209 aa, 23 kDa | 
| Observed molecular weight | 28 kDa | 
| GenBank accession number | BC028566 | 
| Gene Symbol | LIN28 | 
| Gene ID (NCBI) | 79727 | 
| RRID | AB_2135039 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q9H9Z2 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
LIN28 is one of the four key human factors (OCT4, SOX2, NANOG and LIN28) used to reprogram human fibroblasts to an embryonic stem (ES) cell-like state known as the induced pluripotent stem (Ips) cell[PMID: 20139967]. LIN28 is a marker of undifferentiated human embryonic stem cells and a cytoplasmic mRNA-binding protein that binds to and enhances the translation of the IGF2 mRNA[PMID: 21057460]. LIN28 has also been shown to bind to the let-7 pre-miRNA and block production of the mature let-7 microRNA in mouse embryonic stem cells[PMID: 22078496]. Affinity purified rabbit anti-LIN28 can be used to demonstrate pluripotency of ES and Ips cells, and to detect LIN28 transgene expression in the process of reprogramming. This antibody is a rabbit polyclonal antibody raised against full length LIN28 of human origin. The calculated molecular weight of LIN28 is 23 kDa, but the modified LIN28 is about 28 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for LIN28A antibody 11724-1-AP | Download protocol | 
| IP protocol for LIN28A antibody 11724-1-AP | Download protocol | 
| WB protocol for LIN28A antibody 11724-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Nat Genet Lin28 promotes transformation and is associated with advanced human malignancies. | ||
| Nat Genet Lin28a transgenic mice manifest size and puberty phenotypes identified in human genetic association studies. | ||
| Cell Stem Cell Human iPSC-Derived Neural Progenitors Are an Effective Drug Discovery Model for Neurological mtDNA Disorders. | ||
| Cell Res Ythdc2 is an N(6)-methyladenosine binding protein that regulates mammalian spermatogenesis. | 







