Validation Data Gallery
Tested Applications
| Positive WB detected in | human blood tissue |
| Positive IP detected in | human plasma tissue |
| Positive IHC detected in | human breast cancer tissue, human oesophagus cancer tissue, human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IHC | See 1 publications below |
Product Information
60066-1-Ig targets LGALS3BP in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0294 Product name: Recombinant human LGALS3BP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 6-221 aa of BC002403 Sequence: LFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASVVCRALGFENATQALGRAAFGQGSGPIMLDEVQCTGTEASLADCKSLGWLKSNCRHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITL 相同性解析による交差性が予測される生物種 |
| Full Name | lectin, galactoside-binding, soluble, 3 binding protein |
| Calculated molecular weight | 585 aa, 65 kDa |
| Observed molecular weight | 65-90 kDa |
| GenBank accession number | BC002403 |
| Gene Symbol | LGALS3BP |
| Gene ID (NCBI) | 3959 |
| RRID | AB_2265800 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q08380 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Galectin-3-binding protein (LGALS3BP, also known as 90K or Mac-2 BP) is a secreted glycoprotein which binds galectin-3, galectin-1, beta1 integrins, collagens and fibronectin (PMID: 8034587; 8024581; 11146440; 9501082). It has been implicated in tumor metastatic processes, as well as in other cell adhesion and immune functions. Levels of LGALS3BP have been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV) (PMID: 7698018). Western analysis suggests that LGALS3BP is found in breast milk, semen, saliva, urine, and tears, in addition to serum (PMID: 8390986 ). LGALS3BP has a predicted mass of ∼65 kDa. It is heavily glycosylated and shows an apparent molecular weight of 90 kDa on SDS-PAGE.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LGALS3BP antibody 60066-1-Ig | Download protocol |
| IHC protocol for LGALS3BP antibody 60066-1-Ig | Download protocol |
| IP protocol for LGALS3BP antibody 60066-1-Ig | Download protocol |
| WB protocol for LGALS3BP antibody 60066-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
PLoS Pathog Inducible LGALS3BP/90K activates antiviral innate immune responses by targeting TRAF6 and TRAF3 complex. | ||
Proteomics Combination of size-exclusion chromatography and ion exchange adsorption for improving the proteomic analysis of plasma-derived extracellular vesicles | ||
Sci Rep The P4HB/LGALS3BP/NF-kB axis promotes the progression of MIA to IAC in lung adenocarcinoma. | ||
bioRxiv Galectin-3-binding protein inhibits extracellular heparan 6-O-endosulfatse Sulf-2 | ||
Invest Ophthalmol Vis Sci LGALS3BP in Microglia Promotes Retinal Angiogenesis Through PI3K/AKT Pathway During Hypoxia. |














