Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, DU 145 cells, mouse heart tissue, rat heart tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human kidney tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 60 publications below |
| IHC | See 9 publications below |
| IF | See 9 publications below |
| IP | See 1 publications below |
Product Information
14824-1-AP targets LDHB in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, chicken, bovine, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6605 Product name: Recombinant human LDHB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-334 aa of BC002362 Sequence: MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL 相同性解析による交差性が予測される生物種 |
| Full Name | lactate dehydrogenase B |
| Calculated molecular weight | 36 kDa |
| Observed molecular weight | 35 kDa |
| GenBank accession number | BC002362 |
| Gene Symbol | LDHB |
| Gene ID (NCBI) | 3945 |
| RRID | AB_2134953 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P07195 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
LDHB, also named as LDH-H and NY-REN-46, belongs to the LDH/MDH superfamily. And LDH family. It is an enzyme which catalyzes the reversible conversion of pyruvate and NADH to lactate and NAD+ in the glycolytic pathway. LDH comprises LDHA and LDHB, two subunits that are encoded by independent genes. In muscle or liver, most of the LDH is composed of four LDHA subunits, and preferably catalyzes the reduction of pyruvate to lactate. In heart and brain, LDH is mainly composed of four LDHB subunits, and predominantly catalyzes the oxidation of lactate to pyruvate. In other tissues, LDH is composed of both LDHA and LDHB. (PMID: 26269128, 31804482)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LDHB antibody 14824-1-AP | Download protocol |
| IHC protocol for LDHB antibody 14824-1-AP | Download protocol |
| IP protocol for LDHB antibody 14824-1-AP | Download protocol |
| WB protocol for LDHB antibody 14824-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Methods A large-scale targeted proteomics assay resource based on an in vitro human proteome. | ||
Nucleic Acids Res Histone lactylation-boosted ALKBH3 potentiates tumor progression and diminished promyelocytic leukemia protein nuclear condensates by m1A demethylation of SP100A | ||
Nat Commun Enhancement of anaerobic glycolysis - a role of PGC-1α4 in resistance exercise. | ||
Nat Commun Interactome analysis reveals that lncRNA HULC promotes aerobic glycolysis through LDHA and PKM2. | ||
Nat Commun LDHA-mediated ROS generation in chondrocytes is a potential therapeutic target for osteoarthritis. |








