Validation Data Gallery
Tested Applications
| Positive WB detected in | pig liver tissue, pig skeletal muscle tissue, A431 cells, rat skeletal muscle, mouse skeletal muscle | 
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
| Positive IF/ICC detected in | HepG2 cells | 
| Positive FC (Intra) detected in | HepG2 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 | 
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below | 
| WB | See 23 publications below | 
| IHC | See 8 publications below | 
| IF | See 8 publications below | 
| IP | See 3 publications below | 
Product Information
66287-1-Ig targets LDHA in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig | 
| Cited Reactivity | human, mouse, rat | 
| Host / Isotype | Mouse / IgG2b | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag21417 Product name: Recombinant human LDHA protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 283-332 aa of BC067223 Sequence: IKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF相同性解析による交差性が予測される生物種 | 
| Full Name | lactate dehydrogenase A | 
| Calculated molecular weight | 332 aa, 37 kDa | 
| Observed molecular weight | 32-40 kDa | 
| GenBank accession number | BC067223 | 
| Gene Symbol | LDHA | 
| Gene ID (NCBI) | 3939 | 
| RRID | AB_2881670 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Protein A purification | 
| UNIPROT ID | P00338 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
LDHA, also named as LDH-M and NY-REN-59, is an enzyme which catalyzes the inter-conversion of pyruvate and L-lactate with concomitant inter-conversion of NADH and NAD+. LDHA is found in most somatic tissues, though predominantly in muscle tissue and tumours, and belongs to the lactate dehydrogenase family. It has long been known that many human cancers have higher LDHA levels compared to normal tissues. It has also been shown that LDHA plays an important role in the development, invasion and metastasis of malignancies. Mutations in LDHA have been linked to exertional myoglobinuria. LDHA has some isoforms with MW 26-40 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for LDHA antibody 66287-1-Ig | Download protocol | 
| IF protocol for LDHA antibody 66287-1-Ig | Download protocol | 
| IHC protocol for LDHA antibody 66287-1-Ig | Download protocol | 
| WB protocol for LDHA antibody 66287-1-Ig | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Cell Metab Augmentation of scleral glycolysis promotes myopia through histone lactylation | ||
| Cell Metab Dual impacts of serine/glycine-free diet in enhancing antitumor immunity and promoting evasion via PD-L1 lactylation | ||
| Small A Constant Filgotinib Delivery Adhesive Platform Based on Polyethylene Glycol (PEG) Hydrogel for Accelerating Wound Healing via Restoring Macrophage Mitochondrial Homeostasis | ||
| Cell Death Dis FOXQ1 promotes pancreatic cancer cell proliferation, tumor stemness, invasion and metastasis through regulation of LDHA-mediated aerobic glycolysis
 | ||
| Life Sci Aerobic exercise reduced the amount of CHRONO bound to BMAL1 and ameliorated glucose metabolic dysfunction in skeletal muscle of high-fat diet-fed mice | ||







