Validation Data Gallery
Tested Applications
| Positive WB detected in | HepG2 cells, K-562 cells, SH-SY5Y cells, HT-29 cells, A549 cells, C2C12 cells |
| Positive IHC detected in | human breast cancer tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 50 publications below |
| IHC | See 11 publications below |
| IF | See 5 publications below |
| RIP | See 1 publications below |
Product Information
17049-1-AP targets LATS1 in WB, IHC, IF/ICC, RIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, pig, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10709 Product name: Recombinant human LATS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-135 aa of BC015665 Sequence: MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEEDHLSVACSPISLTKPFLI 相同性解析による交差性が予測される生物種 |
| Full Name | LATS, large tumor suppressor, homolog 1 (Drosophila) |
| Calculated molecular weight | 15 kDa, 127 kDa |
| Observed molecular weight | 140-150 kDa, 120 kDa |
| GenBank accession number | BC015665 |
| Gene Symbol | LATS1 |
| Gene ID (NCBI) | 9113 |
| RRID | AB_2281011 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95835 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
LATS1(Large tumor suppressor homolog 1) is also named as WARTS and belongs to the AGC Ser/Thr protein kinase family. The gene encodes a highly conserved (from fly to human) protein kinase that plays a crucial role in the prevention of tumor formation by controlling the progression of mitosis. The expression of both long(170 kDa) and short lats1 isoforms(120 kDa) in vertebrate retinal cells raises the possibility that these lats1 proteins may act as negative key regulators of the cell cycle each of them performing a unique role (PMID:15777619). In mammalian cells, LATS1 was phosphorylated in a cell cycle-dependent manner and complexed with CDC2 in early mitosis (PMID:9988268). LATS1 also can be detected as 120 kDa and 140-150 kDa, and play a key role in the regulation of Hippo pathway (PMID: 27940445).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LATS1 antibody 17049-1-AP | Download protocol |
| IHC protocol for LATS1 antibody 17049-1-AP | Download protocol |
| WB protocol for LATS1 antibody 17049-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Res A phosphatidic acid-binding lncRNA SNHG9 facilitates LATS1 liquid-liquid phase separation to promote oncogenic YAP signaling. | ||
Nat Commun Fusobacterium nucleatum reduces METTL3-mediated m6A modification and contributes to colorectal cancer metastasis. | ||
EMBO J MST2 methylation by PRMT5 inhibits Hippo signaling and promotes pancreatic cancer progression | ||
Theranostics CSRP2 suppresses colorectal cancer progression via p130Cas/Rac1 axis-meditated ERK, PAK, and HIPPO signaling pathways. | ||
JCI Insight KIBRA upregulation increases susceptibility to glomerular injury and correlates with kidney function decline | ||










